<
Western Blot (WB)
(Western Blot detection against Immunogen (36.23kD).)
Mouse anti-Human, Mouse CDADC1 Monoclonal Antibody | anti-CDADC1 antibody
CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1)
Gene Names
CDADC1; NYD-SP15; bA103J18.1; RP11-103J18.2
Reactivity
Human, Mouse
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
CDADC1; Monoclonal Antibody; CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1; Testis Development Protein NYD-SP15; MGC150615; MGC41774; MGC57136; NYD-SP15; BA103J18.1); Anti -CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1; anti-CDADC1 antibody
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A2
Specificity
Recognizes human CDADC1. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH
Applicable Applications for anti-CDADC1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
Immunogen
Partial recombinant corresponding to aa423-515 from human CDADC1 (NP_112173) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.23kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.23kD).)
Western Blot (WB)
(Western Blot analysis of CDADC1 expression in transfected 293T cell line by CDADC1 monoclonal antibody.|Lane 1: CDADC1 transfected lysate (58.5kD).|Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CDADC1 expression in transfected 293T cell line by CDADC1 monoclonal antibody.|Lane 1: CDADC1 transfected lysate (58.5kD).|Lane 2: Non-transfected lysate.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged CDADC1 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CDADC1 is ~0.03ng/ml as a capture antibody.)
Western Blot (WB)
(Western blot analysis of CDADC1 over-expressed 293 cell line, cotransfected with CDADC1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDADC1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Western Blot (WB)
(Western blot analysis of CDADC1 over-expressed 293 cell line, cotransfected with CDADC1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDADC1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Western Blot (WB)
(CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in Raw 264.7.)
Western Blot (WB)
(CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in Raw 264.7.)
Western Blot (WB)
(CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in NIH/3T3.)
Western Blot (WB)
(CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in NIH/3T3.)
Related Product Information for anti-CDADC1 antibody
CDADC1 may play an important role in testicular development and spermatogenesis.
Product Categories/Family for anti-CDADC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
58,455 Da
NCBI Official Full Name
CDADC1 protein
NCBI Official Synonym Full Names
cytidine and dCMP deaminase domain containing 1
NCBI Official Symbol
CDADC1
NCBI Official Synonym Symbols
NYD-SP15; bA103J18.1; RP11-103J18.2
NCBI Protein Information
cytidine and dCMP deaminase domain-containing protein 1; protein kinase NYD-SP15; testis development protein NYD-SP15
UniProt Protein Name
Cytidine and dCMP deaminase domain-containing protein 1
Protein Family
UniProt Gene Name
CDADC1
UniProt Entry Name
CDAC1_HUMAN
Uniprot Description
CDADC1: May play an important role in testicular development and spermatogenesis. Belongs to the cytidine and deoxycytidylate deaminase family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 13q14.2
Molecular Function: zinc ion binding; hydrolase activity
Biological Process: metabolic process
Research Articles on CDADC1
Similar Products
Product Notes
The CDADC1 cdadc1 (Catalog #AAA6013481) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CDADC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml. Researchers should empirically determine the suitability of the CDADC1 cdadc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KCPCDECVPL IKGAGIKQIY AGDVDVGKKK ADISYMRFGE LEGVSKFTWQ LNPSGAYGLE QNEPERRENG VLRPVPQKEE QHQDKKLRLG IH. It is sometimes possible for the material contained within the vial of "CDADC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
