Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.98kD).)

Mouse anti-Human CD9 Monoclonal Antibody | anti-CD9 antibody

CD9 (CD9 Antigen, 5H9 Antigen, Cell Growth-inhibiting Gene 2 Protein, Leukocyte Antigen MIC3, Motility-related Protein, MRP-1, Tetraspanin-29, Tspan-29, p24, MIC3, TSPAN29, GIG2) (PE)

Gene Names
CD9; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD9; Monoclonal Antibody; CD9 (CD9 Antigen; 5H9 Antigen; Cell Growth-inhibiting Gene 2 Protein; Leukocyte Antigen MIC3; Motility-related Protein; MRP-1; Tetraspanin-29; Tspan-29; p24; MIC3; TSPAN29; GIG2) (PE); anti-CD9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A2
Specificity
Recognizes human CD9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CD9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa112-195 from human CD9 (AAH11988) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.98kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.98kD).)

Testing Data

(Detection limit for recombinant GST tagged CD9 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD9 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-CD9 antibody
CD9 is a 24kD type III transmembrane protein also known as tetraspanin, MRP-1 and DRAP-24. It is a member of the tetraspan family (spanning the membrane four times) found on platelets, B cell progenitors, activated lymphocytes, granulocytes, endothelial cells and epithelial cells. CD9 induces adhesion, platelet aggregation, and B cell development. CD9 has been shown to associate with CD63, CD81, CD82, and CD36 and to bind to B1 integrins.
Product Categories/Family for anti-CD9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
928
Molecular Weight
25,416 Da
NCBI Official Full Name
Homo sapiens CD9 molecule, mRNA
NCBI Official Synonym Full Names
CD9 molecule
NCBI Official Symbol
CD9
NCBI Official Synonym Symbols
MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
NCBI Protein Information
CD9 antigen
Protein Family

NCBI Description

This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]

Research Articles on CD9

Similar Products

Product Notes

The CD9 (Catalog #AAA6156996) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD9 (CD9 Antigen, 5H9 Antigen, Cell Growth-inhibiting Gene 2 Protein, Leukocyte Antigen MIC3, Motility-related Protein, MRP-1, Tetraspanin-29, Tspan-29, p24, MIC3, TSPAN29, GIG2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.