Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human CD39L2 Monoclonal Antibody | anti-ENTPD6 antibody

CD39L2 (CD39 Antigen-like 2, CD39-like-2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, Ectonucleoside Triphosphate Diphosphohydrolase 6, ENTPD6, FLJ36711, IL-6SAG, Interleukin 6 Signal Transducer 2, IL6ST2, NTPDase-6)

Gene Names
ENTPD6; CD39L2; IL6ST2; IL-6SAG; NTPDase-6; dJ738P15.3
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CD39L2; Monoclonal Antibody; CD39L2 (CD39 Antigen-like 2; CD39-like-2; dJ738P15.3; DKFZp781G2277; DKFZp781K21102; Ectonucleoside Triphosphate Diphosphohydrolase 6; ENTPD6; FLJ36711; IL-6SAG; Interleukin 6 Signal Transducer 2; IL6ST2; NTPDase-6); Anti -CD39L2 (CD39 Antigen-like 2; anti-ENTPD6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D10
Specificity
Recognizes human ENTPD6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS
Applicable Applications for anti-ENTPD6 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa386-484 from human ENTPD6 (NP_001238) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ENTPD6 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ENTPD6 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)
Related Product Information for anti-ENTPD6 antibody
ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ENTPD6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
955
UniProt Accession #
Molecular Weight
53,246 Da
NCBI Official Full Name
CD39L2
NCBI Official Synonym Full Names
ectonucleoside triphosphate diphosphohydrolase 6 (putative)
NCBI Official Symbol
ENTPD6
NCBI Official Synonym Symbols
CD39L2; IL6ST2; IL-6SAG; NTPDase-6; dJ738P15.3
NCBI Protein Information
ectonucleoside triphosphate diphosphohydrolase 6; NTPDase 6; CD39-like 2; CD39 antigen-like 2; HCV-E2 binding protein 1; interleukin 6 signal transducer-2; ectonucleoside triphosphate diphosphohydrolase 6 (putative function)
UniProt Protein Name
Ectonucleoside triphosphate diphosphohydrolase 6
UniProt Gene Name
ENTPD6
UniProt Synonym Gene Names
CD39L2; IL6ST2; NTPDase 6
UniProt Entry Name
ENTP6_HUMAN

NCBI Description

ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Might support glycosylation reactions in the Golgi apparatus and, when released from cells, might catalyze the hydrolysis of extracellular nucleotides. Hydrolyzes preferentially nucleoside 5'-diphosphates, nucleoside 5'-triphosphates are hydrolyzed only to a minor extent, there is no hydrolysis of nucleoside 5'-monophosphates. The order of activity with different substrates is GDP > IDP >> UDP = CDP >> ADP

By similarity.

Catalytic activity: A nucleoside diphosphate + H2O = a nucleoside phosphate + phosphate.

Cofactor: Ca2+ or Mg2+

By similarity.

Subcellular location: Golgi apparatus membrane; Single-pass type II membrane protein. Secreted. Note: But also occurs in a soluble extracellular form. Ref.7

Tissue specificity: Expressed in most tissues, but predominantly in heart. Ref.7

Sequence similarities: Belongs to the GDA1/CD39 NTPase family.

Research Articles on ENTPD6

Similar Products

Product Notes

The ENTPD6 entpd6 (Catalog #AAA646707) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD39L2 (CD39 Antigen-like 2, CD39-like-2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, Ectonucleoside Triphosphate Diphosphohydrolase 6, ENTPD6, FLJ36711, IL-6SAG, Interleukin 6 Signal Transducer 2, IL6ST2, NTPDase-6) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD39L2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the ENTPD6 entpd6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YDLAAGVGLI DAEKGGSLVV GDFEIAAKYV CRTLETQPQS SPFSCMDLTY VSLLLQEFGF PRSKVLKLTR KIDNVETSWA LGAIFHYIDS LNRQKSPAS. It is sometimes possible for the material contained within the vial of "CD39L2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.