Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CD300C is ~3ng/ml as a capture antibody.)

Mouse anti-Human CD300C Monoclonal Antibody | anti-CD300C antibody

CD300C (CMRF35, CMRF35A, CMRF35A1, IGSF16, CMRF35-like Molecule 6, CD300 Antigen-like Family Member C, CMRF35-A1, Immunoglobulin Superfamily Member 16, CD300c)

Gene Names
CD300C; LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CD300C; Monoclonal Antibody; CD300C (CMRF35; CMRF35A; CMRF35A1; IGSF16; CMRF35-like Molecule 6; CD300 Antigen-like Family Member C; CMRF35-A1; Immunoglobulin Superfamily Member 16; CD300c); Anti -CD300C (CMRF35; anti-CD300C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A10
Specificity
Recognizes human CD300C.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVS
Applicable Applications for anti-CD300C antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa21-130 from human CD300C (NP_006669) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD300C is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD300C is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-CD300C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,830 Da
NCBI Official Full Name
CMRF35-like molecule 6
NCBI Official Synonym Full Names
CD300c molecule
NCBI Official Symbol
CD300C
NCBI Official Synonym Symbols
LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1
NCBI Protein Information
CMRF35-like molecule 6; CD300c antigen; CMRF35 antigen; CD300 antigen-like family member C; immunoglobulin superfamily member 16; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leukocyte immunoglobulin-like receptor
UniProt Protein Name
CMRF35-like molecule 6
Protein Family
UniProt Gene Name
CD300C
UniProt Synonym Gene Names
CMRF35; CMRF35A; CMRF35A1; IGSF16; CLM-6; CMRF-35; IgSF16
UniProt Entry Name
CLM6_HUMAN

NCBI Description

The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM, Mar 2008]

Uniprot Description

CD300C: Belongs to the CD300 family

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: integral to plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: immune system process; cellular defense response; signal transduction

Research Articles on CD300C

Similar Products

Product Notes

The CD300C cd300c (Catalog #AAA6007960) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD300C (CMRF35, CMRF35A, CMRF35A1, IGSF16, CMRF35-like Molecule 6, CD300 Antigen-like Family Member C, CMRF35-A1, Immunoglobulin Superfamily Member 16, CD300c) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD300C can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the CD300C cd300c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GYFPLSHPMT VAGPVGGSLS VQCRYEKEHR TLNKFWCRPP QILRCDKIVE TKGSAGKRNG RVSIRDSPAN LSFTVTLENL TEEDAGTYWC GVDTPWLRDF HDPIVEVEVS. It is sometimes possible for the material contained within the vial of "CD300C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.