Testing Data
(Detection limit for recombinant GST tagged DPP4 is ~1ng/ml as a capture antibody.)
Mouse anti-Human CD26 Monoclonal Antibody | anti-CD26 antibody
CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (Biotin)
Gene Names
DPP4; CD26; ADABP; ADCP2; DPPIV; TP103
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD26; Monoclonal Antibody; CD26 (ADABP; ADCP2; Adenosine Deaminase Complexing Protein 2; Dipeptidyl Peptidase IV; Dipeptidylpeptidase 4; DPP4; DPPIV; Intestinal Dipeptidyl Peptidase; T cell Activation Antigen CD26; TP103) (Biotin); anti-CD26 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C5
Specificity
Recognizes human DPP4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
3913
Applicable Applications for anti-CD26 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa352-451 from human DPP4 (AAH65265) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSRELNP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged DPP4 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged DPP4 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-CD26 antibody
CD26 is a multifunctional protein that exists as a membrane bound form and a soluble form. CD26 has three major functions including adenosine deaminase (ADA) binding, peptidase activity and extracellular matrix binding, all of which can influence T-cell proliferation and chemotaxis. It has also been shown to be involved in apoptosis.
Product Categories/Family for anti-CD26 antibody
NCBI and Uniprot Product Information
NCBI Description
The DPP4 gene encodes dipeptidyl peptidase 4, which is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic type II transmembrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Dipeptidyl peptidase 4 is highly involved in glucose and insulin metabolism, as well as in immune regulation. This protein was shown to be a functional receptor for Middle East respiratory syndrome coronavirus (MERS-CoV), and protein modeling suggests that it may play a similar role with SARS-CoV-2, the virus responsible for COVID-19. [provided by RefSeq, Apr 2020]
Research Articles on CD26
Similar Products
Product Notes
The CD26 (Catalog #AAA6141047) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD26 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD26, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
