Mouse anti-Human CD226 Monoclonal Antibody | anti-CD226 antibody

CD226 (CD226 Antigen, DNAX Accessory Molecule 1, DNAM1, DNAM-1, PTA1, TLiSA1) (HRP)

Cat. Num. AAA6151649

• Gene Names: CD226; PTA1; DNAM1; DNAM-1; TLiSA1
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD226; Monoclonal Antibody; CD226 (CD226 Antigen; DNAX Accessory Molecule 1; DNAM1; DNAM-1; PTA1; TLiSA1) (HRP); anti-CD226 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G8
• Specificity: Recognizes human CD226.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CD226 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa21-127 from CD226 (NP_006557) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD226 is 1ng/ml as a capture antibody.)

Related Product Information for anti-CD226 antibody

CD226 is broadly expressed on T-cells, NK cells, platelets, monocytes and a subset of B cells. CD226 is also expressed by a subset of CD3 positive thymocytes.

Product Categories/Family for anti-CD226 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 171460997
• NCBI GeneID: 10666
• NCBI Accession #: NP_006557
• NCBI GenBank Nucleotide #: NM_006566
• UniProt Accession #: Q15762; B2R818
• Molecular Weight: 29.4 kDa (259aa)
• NCBI Official Full Name: CD226 antigen isoform a
• NCBI Official Synonym Full Names: CD226 molecule
• NCBI Official Symbol: CD226
• NCBI Official Synonym Symbols: PTA1; DNAM1; DNAM-1; TLiSA1
• NCBI Protein Information: CD226 antigen
• UniProt Protein Name: CD226 antigen
• Protein Family: CD226 antigen
• UniProt Gene Name: CD226
• UniProt Synonym Gene Names: DNAM1; DNAM-1
• UniProt Entry Name: CD226_HUMAN

NCBI Description

This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]

Uniprot Description

DNAM-1: Receptor involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell.

Protein type: Cell adhesion; Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 18q22.3

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; external side of plasma membrane; lipid raft

Molecular Function: integrin binding; protein binding; cell adhesion molecule binding; protein kinase binding

Biological Process: regulation of immune response; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; positive regulation of immunoglobulin mediated immune response; cytokine production; cell recognition; cell adhesion; positive regulation of natural killer cell mediated cytotoxicity; signal transduction; positive regulation of mast cell activation