Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CD226 is 1ng/ml as a capture antibody.)

Mouse anti-Human CD226 Monoclonal Antibody | anti-CD226 antibody

CD226 (CD226 Antigen, DNAX Accessory Molecule 1, DNAM1, DNAM-1, PTA1, TLiSA1) (FITC)

Gene Names
CD226; PTA1; DNAM1; DNAM-1; TLiSA1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD226; Monoclonal Antibody; CD226 (CD226 Antigen; DNAX Accessory Molecule 1; DNAM1; DNAM-1; PTA1; TLiSA1) (FITC); anti-CD226 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G8
Specificity
Recognizes human CD226.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CD226 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa21-127 from CD226 (NP_006557) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD226 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD226 is 1ng/ml as a capture antibody.)
Related Product Information for anti-CD226 antibody
CD226 is broadly expressed on T-cells, NK cells, platelets, monocytes and a subset of B cells. CD226 is also expressed by a subset of CD3 positive thymocytes.
Product Categories/Family for anti-CD226 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.4 kDa (259aa)
NCBI Official Full Name
CD226 antigen isoform a
NCBI Official Synonym Full Names
CD226 molecule
NCBI Official Symbol
CD226
NCBI Official Synonym Symbols
PTA1; DNAM1; DNAM-1; TLiSA1
NCBI Protein Information
CD226 antigen
UniProt Protein Name
CD226 antigen
Protein Family
UniProt Gene Name
CD226
UniProt Synonym Gene Names
DNAM1; DNAM-1
UniProt Entry Name
CD226_HUMAN

NCBI Description

This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]

Uniprot Description

DNAM-1: Receptor involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell.

Protein type: Cell adhesion; Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 18q22.3

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; external side of plasma membrane; lipid raft

Molecular Function: integrin binding; protein binding; cell adhesion molecule binding; protein kinase binding

Biological Process: regulation of immune response; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; positive regulation of immunoglobulin mediated immune response; cytokine production; cell recognition; cell adhesion; positive regulation of natural killer cell mediated cytotoxicity; signal transduction; positive regulation of mast cell activation

Research Articles on CD226

Similar Products

Product Notes

The CD226 cd226 (Catalog #AAA6146346) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD226 (CD226 Antigen, DNAX Accessory Molecule 1, DNAM1, DNAM-1, PTA1, TLiSA1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD226 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD226 cd226 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD226, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.