Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ITGAM is 1ng/ml as a capture antibody.)

Mouse anti-Human CD11B Monoclonal Antibody | anti-CD11B antibody

CD11B (Integrin alpha-M, CD11 Antigen-like Family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A, MGC117044) (HRP)

Gene Names
ITGAM; CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD11B; Monoclonal Antibody; CD11B (Integrin alpha-M; CD11 Antigen-like Family Member B; CR-3 alpha Chain; Cell Surface Glycoprotein MAC-1 Subunit alpha; Leukocyte Adhesion Receptor MO1; Neutrophil Adherence Receptor; ITGAM; CR3A; MGC117044) (HRP); anti-CD11B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4E10
Specificity
Recognizes human ITGAM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CD11B antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa111-220 from human ITGAM (NP_000623) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ITGAM is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ITGAM is 1ng/ml as a capture antibody.)
Related Product Information for anti-CD11B antibody
CD11b is a 165-170kD type I transmembrane glycoprotein also known as aM integrin, Mac-1, CR3, and C3biR. CD11b non-covalently associates with integrin b2 (CD18) and is expressed on granulocytes, monocytes/macrophages, dendritic cells, NK cells, and subsets of T and B cells. CD11b/CD18 is critical for the transendothelial migration of monocytes and neutrophils. The ICRF44 antibody inhibits granulocyte activation in response to fMLP.
Product Categories/Family for anti-CD11B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
127,307 Da
NCBI Official Full Name
integrin alpha-M isoform 2
NCBI Official Synonym Full Names
integrin, alpha M (complement component 3 receptor 3 subunit)
NCBI Official Symbol
ITGAM
NCBI Official Synonym Symbols
CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6
NCBI Protein Information
integrin alpha-M; CD11 antigen-like family member B; CR-3 alpha chain; antigen CD11b (p170); cell surface glycoprotein MAC-1 subunit alpha; leukocyte adhesion receptor MO1; macrophage antigen alpha polypeptide; neutrophil adherence receptor alpha-M subuni
UniProt Protein Name
Integrin alpha-M
UniProt Gene Name
ITGAM
UniProt Synonym Gene Names
CD11B; CR3A
UniProt Entry Name
ITAM_HUMAN

Uniprot Description

ITGAM: a single-pass type I membrane protein of the integrin alpha chain family. Implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles. Also known as CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the RGD peptide in C3b. A receptor for fibrinogen, factor X and ICAM1. Heterodimer of an alpha and a beta subunit. Alpha-M associates with beta-2. Predominantly expressed in monocytes and granulocytes.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cell surface; plasma membrane; integrin complex; nucleus; external side of plasma membrane

Molecular Function: heparan sulfate proteoglycan binding; heparin binding; protein binding; opsonin binding; protein heterodimerization activity; metal ion binding; glycoprotein binding

Biological Process: integrin-mediated signaling pathway; neutrophil chemotaxis; extracellular matrix organization and biogenesis; microglia development; activated T cell proliferation; leukocyte migration during inflammatory response; cellular extravasation; toll-like receptor signaling pathway; innate immune response; cell adhesion; blood coagulation; toll-like receptor 4 signaling pathway; leukocyte migration

Disease: Systemic Lupus Erythematosus, Susceptibility To, 6

Similar Products

Product Notes

The CD11B itgam (Catalog #AAA6151635) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD11B (Integrin alpha-M, CD11 Antigen-like Family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A, MGC117044) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD11B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD11B itgam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD11B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.