Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CCT7 monoclonal antibody Western Blot analysis of CCT7 expression in HL-60)

Mouse CCT7 Monoclonal Antibody | anti-CCT7 antibody

CCT7 (T-complex Protein 1 Subunit eta, TCP-1-eta, CCT-eta, HIV-1 Nef-interacting Protein, CCTH, NIP7-1) (AP)

Gene Names
CCT7; CCTH; CCTETA; NIP7-1; TCP1ETA
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCT7; Monoclonal Antibody; CCT7 (T-complex Protein 1 Subunit eta; TCP-1-eta; CCT-eta; HIV-1 Nef-interacting Protein; CCTH; NIP7-1) (AP); anti-CCT7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D6
Specificity
Recognizes human CCT7. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CCT7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa425-528 from CCT7 (AAH19296) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CCT7 monoclonal antibody Western Blot analysis of CCT7 expression in HL-60)

Western Blot (WB) (CCT7 monoclonal antibody Western Blot analysis of CCT7 expression in HL-60)

Western Blot (WB)

(CCT7 monoclonal antibody Western Blot analysis of CCT7 expression in Raw 264.7)

Western Blot (WB) (CCT7 monoclonal antibody Western Blot analysis of CCT7 expression in Raw 264.7)

Western Blot (WB)

(CCT7 monoclonal antibody Western Blot analysis of CCT7 expression in K-562.)

Western Blot (WB) (CCT7 monoclonal antibody Western Blot analysis of CCT7 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of CCT7 expression in transfected 293T cell line by CCT7 monoclonal antibody. Lane 1: CCT7 transfected lysate (59.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCT7 expression in transfected 293T cell line by CCT7 monoclonal antibody. Lane 1: CCT7 transfected lysate (59.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CCT7 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CCT7 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(CCT7 monoclonal antibody Western Blot analysis of CCT7 expression in human pancreas.)

Western Blot (WB) (CCT7 monoclonal antibody Western Blot analysis of CCT7 expression in human pancreas.)

Western Blot (WB)

(Western Blot detection against Immunogen (37.44kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.44kD).)
Related Product Information for anti-CCT7 antibody
This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 5 and 6.
Product Categories/Family for anti-CCT7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
50,352 Da
NCBI Official Full Name
Homo sapiens chaperonin containing TCP1, subunit 7 (eta), mRNA
NCBI Official Synonym Full Names
chaperonin containing TCP1 subunit 7
NCBI Official Symbol
CCT7
NCBI Official Synonym Symbols
CCTH; CCTETA; NIP7-1; TCP1ETA
NCBI Protein Information
T-complex protein 1 subunit eta

NCBI Description

This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 5 and 6. [provided by RefSeq, Oct 2009]

Research Articles on CCT7

Similar Products

Product Notes

The CCT7 (Catalog #AAA6130417) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCT7 (T-complex Protein 1 Subunit eta, TCP-1-eta, CCT-eta, HIV-1 Nef-interacting Protein, CCTH, NIP7-1) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCT7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCT7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCT7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.