Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse CCR4-Not Transcription Complex, Subunit 2 Monoclonal Antibody | anti-CNOT2 antibody

CCR4-Not Transcription Complex, Subunit 2 (CNOT2, CDC36, HSPC131, Negative Regulator of Transcription Subunit 2 Homolog, NOT2H)

Gene Names
CNOT2; NOT2; CDC36; NOT2H; HSPC131; FLJ26456
Applications
Western Blot, Gel Super Shift Assay
Purity
Affinity Purified
Purified by Protein G affinity chromatography.
Synonyms
CCR4-Not Transcription Complex; Subunit 2; Monoclonal Antibody; Subunit 2 (CNOT2; CDC36; HSPC131; Negative Regulator of Transcription Subunit 2 Homolog; NOT2H); Anti -CCR4-Not Transcription Complex; anti-CNOT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a
Clone Number
8C59
Specificity
Recognizes human CCR4-Not Transcription Complex, Subunit 2.
Purity/Purification
Affinity Purified
Purified by Protein G affinity chromatography.
Form/Format
Supplied as a sterile-filtered liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.
Applicable Applications for anti-CNOT2 antibody
Western Blot (WB), Gel Shift Assay (GS/EMSA)
Application Notes
Suitable for use in Western Blot and Dot Blot.
Immunogen
Partial sequence of recombinant full-length protein to human CCR4-Not Transcription Complex, Subunit 2 corresponding to amino acids within the internal portion of the protein. Immunogen sequence: FPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLP
Preparation and Storage
May be stored at 4 degree C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20 degree C. Aliquots are stable for at least 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for anti-CNOT2 antibody
The CCR4-Not complex is a highly conserved regulator of mRNA metabolism.
Product Categories/Family for anti-CNOT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
59,738 Da
NCBI Official Full Name
CCR4-NOT transcription complex, subunit 2
NCBI Official Synonym Full Names
CCR4-NOT transcription complex, subunit 2
NCBI Official Symbol
CNOT2
NCBI Official Synonym Symbols
NOT2; CDC36; NOT2H; HSPC131; FLJ26456
NCBI Protein Information
CCR4-NOT transcription complex subunit 2; CCR4-associated factor 2; negative regulator of transcription 2
UniProt Protein Name
CCR4-NOT transcription complex subunit 2
UniProt Gene Name
CNOT2
UniProt Synonym Gene Names
CDC36; NOT2
UniProt Entry Name
CNOT2_HUMAN

NCBI Description

This gene encodes a subunit of the multi-component CCR4-NOT complex. The CCR4-NOT complex regulates mRNA synthesis and degradation and is also thought to be involved in mRNA splicing, transport and localization. The encoded protein interacts with histone deacetylases and functions as a repressor of polymerase II transcription. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq]

Uniprot Description

NOT2: The CCR4-NOT complex functions as general transcription regulation complex. Subunit of the CCR4-NOT core complex that contains CHAF1A, CHAF1B, CNOT1, CNOT2, CNOT3, CNOT4, CNOT6 and CNOT8. Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocytes. Belongs to the CNOT2/3/5 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 12q15

Cellular Component: membrane; cytoplasm; nucleus; cytosol; CCR4-NOT complex

Molecular Function: protein binding; poly(A)-specific ribonuclease activity

Biological Process: regulation of translation; regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; poly(A) tail shortening; RNA-mediated gene silencing; gene expression; negative regulation of transcription from RNA polymerase II promoter; negative regulation of estrogen receptor signaling pathway; trophectodermal cell differentiation; mRNA catabolic process, deadenylation-dependent decay

Research Articles on CNOT2

Similar Products

Product Notes

The CNOT2 cnot2 (Catalog #AAA603904) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CCR4-Not Transcription Complex, Subunit 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Gel Shift Assay (GS/EMSA). Suitable for use in Western Blot and Dot Blot. Researchers should empirically determine the suitability of the CNOT2 cnot2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCR4-Not Transcription Complex, Subunit 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.