Mouse anti-Human CCNH Monoclonal Antibody | anti-CCNH antibody

CCNH (Cyclin H, Cyclin-H, MO15-associated Protein, p34, p37) (Biotin)

Cat. Num. AAA6141014

• Gene Names: CCNH; CAK; p34; p37; CycH
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CCNH; Monoclonal Antibody; CCNH (Cyclin H; Cyclin-H; MO15-associated Protein; p34; p37) (Biotin); anti-CCNH antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B8
• Specificity: Recognizes human CCNH.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CCNH antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-110 from human CCNH (AAH05280) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAF
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(Western Blot analysis of CCNH expression in transfected 293T cell line by CCNH monoclonal antibody. Lane 1: CCNH transfected lysate (37.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CCNH on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CCNH on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CCNH is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(CCNH monoclonal antibody, Western Blot analysis of CCNH expression in HeLa.)

Product Categories/Family for anti-CCNH antibody

Antibodies; Cyclin

References

1. Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair. Nakazawa Y, Sasaki K, Mitsutake N, Matsuse M, Shimada M, Nardo T, Takahashi Y, Ohyama K, Ito K, Mishima H, Nomura M, Kinoshita A, Ono S, Takenaka K, Masuyama R, Kudo T, Slor H, Utani A, Tateishi S, Yamashita S, Stefanini M, Lehmann AR, Yoshiura KI, Ogi T.Nat Genet. 2012 Apr 1. doi: 10.1038/ng.2229.

NCBI and Uniprot Product Information

• NCBI GI #: 13528977
• NCBI GeneID: 902
• Molecular Weight: 37,643 Da
• NCBI Official Full Name: Homo sapiens cyclin H, mRNA
• NCBI Official Synonym Full Names: cyclin H
• NCBI Official Symbol: CCNH
• NCBI Official Synonym Symbols: CAK; p34; p37; CycH
• NCBI Protein Information: cyclin-H
• Protein Family: Cyclin

NCBI Description

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. A pseudogene of this gene is found on chromosome 4. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Nov 2010]