Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (65.49kD).)

Mouse anti-Human CCDC131 Monoclonal Antibody

CCDC131 (Zinc Finger, C3H1-Type Containing, CCDC131, DKFZp686A0722, KIAA0546, MGC23401, MGC90200, PSRC2)

Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CCDC131; Monoclonal Antibody; CCDC131 (Zinc Finger; C3H1-Type Containing; DKFZp686A0722; KIAA0546; MGC23401; MGC90200; PSRC2); Anti -CCDC131 (Zinc Finger; anti-CCDC131 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A3
Specificity
Recognizes human CCDC131.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MATADTPAPASSGLSPKEEGELEDGEISDDDNNSQIRSRSSSSSSGGGLLPYPRRRPPHSARGGGSGGGGGSSSSSSSSQQQLRNFSRSRHASERGHLRGPSSYRPKEPFRSHPPSVRMPSSSLSESSPRPSFWERSHLALDRFRFRGRPYRGGSRWSRGRGVGERGGKPGCRPPLGGGAGSGFSSSQSWREPSPPRKSSKSFGRSPSRKQNYSSKNENCVEETFEDLLLKYKQIQLELECINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEVAPEEKTQVKTFQAFELKPLRQKLTLPGDKNRLKKVKDGAKPLSLKSDTTDSSQGIPYRVKEGFTPIPGLKFSA
Applicable Applications for anti-CCDC131 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length recombinant protein corresponding to aa1-359 from human CCDC131 (AAH15679) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (65.49kD).)

Western Blot (WB) (Western Blot detection against Immunogen (65.49kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZFC3H1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ZFC3H1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-CCDC131 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
coiled-coil domain-containing protein 131

Similar Products

Product Notes

The CCDC131 (Catalog #AAA6006198) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCDC131 (Zinc Finger, C3H1-Type Containing, CCDC131, DKFZp686A0722, KIAA0546, MGC23401, MGC90200, PSRC2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC131 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the CCDC131 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATADTPAPA SSGLSPKEEG ELEDGEISDD DNNSQIRSRS SSSSSGGGLL PYPRRRPPHS ARGGGSGGGG GSSSSSSSSQ QQLRNFSRSR HASERGHLRG PSSYRPKEPF RSHPPSVRMP SSSLSESSPR PSFWERSHLA LDRFRFRGRP YRGGSRWSRG RGVGERGGKP GCRPPLGGGA GSGFSSSQSW REPSPPRKSS KSFGRSPSRK QNYSSKNENC VEETFEDLLL KYKQIQLELE CINKDEKLAL SSKEENVQED PKTLNFEDQT STDNVSITKD SSKEVAPEEK TQVKTFQAFE LKPLRQKLTL PGDKNRLKKV KDGAKPLSLK SDTTDSSQGI PYRVKEGFTP IPGLKFSA. It is sometimes possible for the material contained within the vial of "CCDC131, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.