Mouse anti-Human CBX5 Monoclonal Antibody | anti-CBX5 antibody

CBX5 (Chromobox Protein Homolog 5, Antigen p25, Heterochromatin Protein 1 Homolog alpha, HP1 alpha, HP1A) APC

Cat. Num. AAA6135691

• Gene Names: CBX5; HP1; HP1A; HEL25
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CBX5; Monoclonal Antibody; CBX5 (Chromobox Protein Homolog 5; Antigen p25; Heterochromatin Protein 1 Homolog alpha; HP1 alpha; HP1A) APC; anti-CBX5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E11-3A10
• Specificity: Recognizes human CBX5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CBX5 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-192 from CBX5 (AAH06821) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (47.12kD).)

Western Blot (WB)

(CBX5 monoclonal antibody Western Blot analysis of CBX5 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of CBX5 expression in transfected 293T cell line by CBX5 monoclonal antibody. Lane 1: CBX5 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CBX5 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CBX5 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-CBX5 antibody

Antibodies; Chromatin Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13905073
• NCBI GeneID: 23468
• Molecular Weight: 22,225 Da
• NCBI Official Full Name: Homo sapiens chromobox homolog 5 (HP1 alpha homolog, Drosophila), mRNA
• NCBI Official Synonym Full Names: chromobox 5
• NCBI Official Symbol: CBX5
• NCBI Official Synonym Symbols: HP1; HP1A; HEL25
• NCBI Protein Information: chromobox protein homolog 5
• Protein Family: Chromobox protein

NCBI Description

This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]