Mouse anti-Human CAPN3 Monoclonal Antibody | anti-CAPN3 antibody

CAPN3 (Calpain-3, Calpain L3, Calpain p94, Calcium-activated Neutral Proteinase 3, CANP 3, Muscle-specific Calcium-activated Neutral Protease 3, New Calpain 1, nCL-1, NCL1, CANPL3, CANP3) (MaxLight 650)

Cat. Num. AAA6221245

• Gene Names: CAPN3; p94; CANP3; LGMD2; nCL-1; CANPL3; LGMD2A
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CAPN3; Monoclonal Antibody; CAPN3 (Calpain-3; Calpain L3; Calpain p94; Calcium-activated Neutral Proteinase 3; CANP 3; Muscle-specific Calcium-activated Neutral Protease 3; New Calpain 1; nCL-1; NCL1; CANPL3; CANP3) (MaxLight 650); anti-CAPN3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B2
• Specificity: Recognizes human CAPN3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

• Applicable Applications for anti-CAPN3 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa210-309 from human CAPN3 (AAH03169.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
• Conjugate: MaxLight650
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-CAPN3 antibody

CAPN3, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. The protein is a muscle-specific member of the calpain large subunit family that specifically binds to titin.

Product Categories/Family for anti-CAPN3 antibody

Antibodies; Calpain

NCBI and Uniprot Product Information

• NCBI GI #: 13111992
• NCBI GeneID: 825
• Molecular Weight: 18,246 Da
• NCBI Official Full Name: Homo sapiens calpain 3, (p94), mRNA
• NCBI Official Synonym Full Names: calpain 3
• NCBI Official Symbol: CAPN3
• NCBI Official Synonym Symbols: p94; CANP3; LGMD2; nCL-1; CANPL3; LGMD2A
• NCBI Protein Information: calpain-3
• Protein Family: Calpain

NCBI Description

Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed. [provided by RefSeq, Jul 2008]