Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.56kD).)

Mouse anti-Human CAMK1D Monoclonal Antibody | anti-CAMK1D antibody

CAMK1D (Calcium/Calmodulin-dependent Protein Kinase ID, Calcium/calmodulin-dependent Protein kinase type 1D, CaM-K1, Camk1D, CaMKID, CaMKI delta, CaMKI-delta, CaM-KI delta, CamKI-like protein kinase, CaM kinase ID, CaM kinase I delta, CKLiK) APC

Gene Names
CAMK1D; CKLiK; CaM-K1; CaMKID
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CAMK1D; Monoclonal Antibody; CAMK1D (Calcium/Calmodulin-dependent Protein Kinase ID; Calcium/calmodulin-dependent Protein kinase type 1D; CaM-K1; Camk1D; CaMKID; CaMKI delta; CaMKI-delta; CaM-KI delta; CamKI-like protein kinase; CaM kinase ID; CaM kinase I delta; CKLiK) APC; anti-CAMK1D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3H8
Specificity
Recognizes human CAMK1D.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CAMK1D antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-96 from human CAMK1D (AAH35745) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB)

(Western Blot analysis of CAMK1D expression in transfected 293T cell line by CAMK1D monoclonal antibody. Lane 1: CAMK1D transfected lysate (42.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CAMK1D expression in transfected 293T cell line by CAMK1D monoclonal antibody. Lane 1: CAMK1D transfected lysate (42.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CAMK1D on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CAMK1D on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CAMK1D is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CAMK1D is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-CAMK1D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
40,190 Da
NCBI Official Full Name
Homo sapiens calcium/calmodulin-dependent protein kinase ID, mRNA
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase ID
NCBI Official Symbol
CAMK1D
NCBI Official Synonym Symbols
CKLiK; CaM-K1; CaMKID
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type 1D

NCBI Description

This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jan 2015]

Research Articles on CAMK1D

Similar Products

Product Notes

The CAMK1D (Catalog #AAA6135644) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CAMK1D (Calcium/Calmodulin-dependent Protein Kinase ID, Calcium/calmodulin-dependent Protein kinase type 1D, CaM-K1, Camk1D, CaMKID, CaMKI delta, CaMKI-delta, CaM-KI delta, CamKI-like protein kinase, CaM kinase ID, CaM kinase I delta, CKLiK) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAMK1D can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAMK1D for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAMK1D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.