Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human CAMK1 Monoclonal Antibody | anti-CAMK1 antibody

CAMK1 (Calcium/Calmodulin-dependent Protein Kinase Type 1, CaM Kinase I, CaM-KI, CaM Kinase I alpha, CaMKI-alpha, MGC120317, MGC120318) APC

Gene Names
CAMK1; CAMKI
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CAMK1; Monoclonal Antibody; CAMK1 (Calcium/Calmodulin-dependent Protein Kinase Type 1; CaM Kinase I; CaM-KI; CaM Kinase I alpha; CaMKI-alpha; MGC120317; MGC120318) APC; anti-CAMK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G1
Specificity
Recognizes human CAMK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CAMK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa271-371 from CAMK1 (NP_003647) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGTELSPTLPHQL*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(CAMK1 monoclonal antibody, Western Blot analysis of CAMK1 expression in HL-60.)

Western Blot (WB) (CAMK1 monoclonal antibody, Western Blot analysis of CAMK1 expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged CAMK1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CAMK1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CAMK1 antibody
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, regulates transcription activators activity, cell cycle, hormone production, cell differentiation, actin filament organization and neurite outgrowth. Recognizes the substrate consensus sequence [MVLIF]-x-R-x(2)-[ST]-x(3)-[MVLIF]. Regulates axonal extension and growth cone motility in hippocampal and cerebellar nerve cells. Upon NMDA receptor-mediated Ca2+ elevation, promotes dendritic growth in hippocampal neurons and is essential in synapses for full long-term potentiation (LTP) and ERK2-dependent translational activation. Downstream of NMDA receptors, promotes the formation of spines and synapses in hippocampal neurons by phosphorylating ARHGEF7/BETAPIX on 'Ser-694', which results in the enhancement of ARHGEF7 activity and activation of RAC1. Promotes neuronal differentiation and neurite outgrowth by activation and phosphorylation of MARK2 on 'Ser-91', 'Ser-92', 'Ser-93' and 'Ser-294'. Promotes nuclear export of HDAC5 and binding to 14-3-3 by phosphorylation of 'Ser-259' and 'Ser-498' in the regulation of muscle cell differentiation. Regulates NUMB-mediated endocytosis by phosphorylation of NUMB on 'Ser-276' and 'Ser-295'. Involved in the regulation of basal and estrogen-stimulated migration of medulloblastoma cells through ARHGEF7/BETAPIX phosphorylation By similarity. Is required for proper activation of cyclin-D1/CDK4 complex during G1 progression in diploid fibroblasts. Plays a role in K+ and ANG2-mediated regulation of the aldosterone synthase (CYP11B2) to produce aldosterone in the adrenal cortex. Phosphorylates EIF4G3/eIF4GII. In vitro phosphorylates CREB1, ATF1, CFTR, MYL9 and SYN1/synapsin I.
Product Categories/Family for anti-CAMK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,337 Da
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type 1
NCBI Official Synonym Full Names
calcium/calmodulin-dependent protein kinase I
NCBI Official Symbol
CAMK1
NCBI Official Synonym Symbols
CAMKI
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type 1; caM kinase I alpha; caM-KI; caMKI-alpha
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type 1
UniProt Gene Name
CAMK1
UniProt Synonym Gene Names
CaM-KI; CaMKI-alpha
UniProt Entry Name
KCC1A_HUMAN

Uniprot Description

CAMK1A: an ubiquitous protein kinase of the CAMK1 family. Activated by Ca(2+)/calmodulin. Must be phosphorylated to be maximally active. Substrates include synapsin I.

Protein type: Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; EC 2.7.11.17; CAMK group; CAMK1 family

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: cytoplasm; nucleus

Molecular Function: calmodulin binding; protein binding; calmodulin-dependent protein kinase activity; ATP binding

Biological Process: positive regulation of syncytium formation by plasma membrane fusion; regulation of muscle cell differentiation; nucleocytoplasmic transport; signal transduction; cell cycle; protein amino acid phosphorylation; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein export from nucleus; positive regulation of synapse structural plasticity; regulation of protein localization; regulation of protein binding; positive regulation of muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein binding

Similar Products

Product Notes

The CAMK1 camk1 (Catalog #AAA6135643) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CAMK1 (Calcium/Calmodulin-dependent Protein Kinase Type 1, CaM Kinase I, CaM-KI, CaM Kinase I alpha, CaMKI-alpha, MGC120317, MGC120318) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAMK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAMK1 camk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAMK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.