Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CAMK1 monoclonal antibody (M02), clone 2B6 Western Blot analysis of CAMK1 expression in HepG2 (Cat # L019V1).)

Mouse CAMK1 Monoclonal Antibody | anti-CAMK1 antibody

CAMK1 (Calcium/Calmodulin-Dependent Protein Kinase I, CAMKI, MGC120317, MGC120318) (HRP)

Gene Names
CAMK1; CAMKI
Applications
Western Blot
Purity
Purified
Synonyms
CAMK1; Monoclonal Antibody; CAMK1 (Calcium/Calmodulin-Dependent Protein Kinase I; CAMKI; MGC120317; MGC120318) (HRP); Calcium/Calmodulin-Dependent Protein Kinase I; MGC120318; anti-CAMK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B6
Specificity
Recognizes CAMK1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CAMK1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CAMK1 (NP_003647, 271aa-370aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGTELSPTLPHQL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CAMK1 monoclonal antibody (M02), clone 2B6 Western Blot analysis of CAMK1 expression in HepG2 (Cat # L019V1).)

Western Blot (WB) (CAMK1 monoclonal antibody (M02), clone 2B6 Western Blot analysis of CAMK1 expression in HepG2 (Cat # L019V1).)
Product Categories/Family for anti-CAMK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,337 Da
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type 1
NCBI Official Synonym Full Names
calcium/calmodulin-dependent protein kinase I
NCBI Official Symbol
CAMK1
NCBI Official Synonym Symbols
CAMKI
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type 1; caM kinase I alpha; caM-KI; caMKI-alpha
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type 1
UniProt Gene Name
CAMK1
UniProt Synonym Gene Names
CaM-KI; CaMKI-alpha
UniProt Entry Name
KCC1A_HUMAN

Uniprot Description

CAMK1A: an ubiquitous protein kinase of the CAMK1 family. Activated by Ca(2+)/calmodulin. Must be phosphorylated to be maximally active. Substrates include synapsin I.

Protein type: Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; EC 2.7.11.17; CAMK group; CAMK1 family

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: cytoplasm; nucleus

Molecular Function: calmodulin binding; protein binding; calmodulin-dependent protein kinase activity; ATP binding

Biological Process: positive regulation of syncytium formation by plasma membrane fusion; regulation of muscle cell differentiation; nucleocytoplasmic transport; signal transduction; cell cycle; protein amino acid phosphorylation; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein export from nucleus; positive regulation of synapse structural plasticity; regulation of protein localization; regulation of protein binding; positive regulation of muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein binding

Similar Products

Product Notes

The CAMK1 camk1 (Catalog #AAA6179888) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CAMK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAMK1 camk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAMK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.