Western Blot (WB)
(Western Blot analysis of CALCOCO2 expression in transfected 293T cell line by CALCOCO2 monoclonal antibody (M06), clone 2H5.Lane 1: CALCOCO2 transfected lysate (Predicted MW: 52.3 KDa).Lane 2: Non-transfected lysate.)
Mouse CALCOCO2 Monoclonal Antibody | anti-CALCOCO2 antibody
CALCOCO2 (Calcium Binding and Coiled-coil Domain 2, MGC17318, NDP52) (PE)
Gene Names
CALCOCO2; NDP52
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CALCOCO2; Monoclonal Antibody; CALCOCO2 (Calcium Binding and Coiled-coil Domain 2; MGC17318; NDP52) (PE); Calcium Binding and Coiled-coil Domain 2; NDP52; anti-CALCOCO2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2H5
Specificity
Recognizes CALCOCO2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CALCOCO2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CALCOCO2 (NP_005822, 347aa-446aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of CALCOCO2 expression in transfected 293T cell line by CALCOCO2 monoclonal antibody (M06), clone 2H5.Lane 1: CALCOCO2 transfected lysate (Predicted MW: 52.3 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CALCOCO2 expression in transfected 293T cell line by CALCOCO2 monoclonal antibody (M06), clone 2H5.Lane 1: CALCOCO2 transfected lysate (Predicted MW: 52.3 KDa).Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CALCOCO2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CALCOCO2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CALCOCO2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CALCOCO2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-CALCOCO2 antibody
The protein encoded by this gene is a subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles. [provided by RefSeq]
Product Categories/Family for anti-CALCOCO2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,669 Da
NCBI Official Full Name
calcium-binding and coiled-coil domain-containing protein 2 isoform 3
NCBI Official Synonym Full Names
calcium binding and coiled-coil domain 2
NCBI Official Symbol
CALCOCO2
NCBI Official Synonym Symbols
NDP52
NCBI Protein Information
calcium-binding and coiled-coil domain-containing protein 2
UniProt Protein Name
Calcium-binding and coiled-coil domain-containing protein 2
Protein Family
UniProt Gene Name
CALCOCO2
UniProt Synonym Gene Names
NDP52; Nuclear domain 10 protein 52
UniProt Entry Name
CACO2_HUMAN
NCBI Description
This gene encodes a coiled-coil domain-containing protein. The encoded protein functions as a receptor for ubiquitin-coated bacteria and plays an important role in innate immunity by mediating macroautophagy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
Research Articles on CALCOCO2
Similar Products
Product Notes
The CALCOCO2 calcoco2 (Catalog #AAA6187340) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CALCOCO2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CALCOCO2 calcoco2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CALCOCO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
