Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse CADM1 Monoclonal Antibody | anti-CADM1 antibody

CADM1 (Cell Adhesion Molecule 1, BL2, DKFZp686F1789, IGSF4, IGSF4A, MGC149785, MGC51880, NECL2, Necl-2, RA175, ST17, SYNCAM, TSLC1, sTSLC-1, sgIGSF, synCAM1) (MaxLight 550)

Gene Names
CADM1; BL2; ST17; IGSF4; NECL2; RA175; TSLC1; IGSF4A; Necl-2; SYNCAM; sgIGSF; sTSLC-1; synCAM1
Applications
FLISA
Purity
Purified
Synonyms
CADM1; Monoclonal Antibody; CADM1 (Cell Adhesion Molecule 1; BL2; DKFZp686F1789; IGSF4; IGSF4A; MGC149785; MGC51880; NECL2; Necl-2; RA175; ST17; SYNCAM; TSLC1; sTSLC-1; sgIGSF; synCAM1) (MaxLight 550); Cell Adhesion Molecule 1; synCAM1; anti-CADM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F6
Specificity
Recognizes CADM1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-CADM1 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CADM1 (NP_055148, 151aa-250aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CADM1 antibody
Mouse monoclonal antibody raised against a partial recombinant CADM1.
Product Categories/Family for anti-CADM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.4 kDa (353aa) confirmed by MALDI-TOF
NCBI Official Full Name
cell adhesion molecule 1 isoform D
NCBI Official Synonym Full Names
cell adhesion molecule 1
NCBI Official Symbol
CADM1
NCBI Official Synonym Symbols
BL2; ST17; IGSF4; NECL2; RA175; TSLC1; IGSF4A; Necl-2; SYNCAM; sgIGSF; sTSLC-1; synCAM1
NCBI Protein Information
cell adhesion molecule 1
UniProt Protein Name
Cell adhesion molecule 1
Protein Family
UniProt Gene Name
CADM1
UniProt Synonym Gene Names
IGSF4; IGSF4A; NECL2; SYNCAM; TSLC1; IgSF4; NECL-2; SgIgSF; SynCAM; TSLC-1
UniProt Entry Name
CADM1_HUMAN

Uniprot Description

CADM1: a single-pass type I membrane protein that ediates homophilic cell-cell adhesion, and heterophilic cell-cell adhesion with CADM3 and PVRL3 in a Ca(2+)-independent manner. Acts as a tumor suppressor in non-small-cell lung cancer (NSCLC) cells. Interaction with CRTAM promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo. May contribute to the less invasive phenotypes of lepidic growth tumor cells. In mast cells, may mediate attachment to and promote communication with nerves. CADM1, together with MITF, is essential for development and survival of mast cells in vivo. May act as a synaptic cell adhesion molecule that drives synapse assembly. May be involved in neuronal migration, axon growth, pathfinding, and fasciculation on the axons of differentiating neurons. May play diverse roles in the spermatogenesis including in the adhesion of spermatocytes and spermatids to Sertoli cells and for their normal differentiation into mature spermatozoa. Belongs to the nectin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Vesicle; Apoptosis; Tumor suppressor; Cell adhesion

Chromosomal Location of Human Ortholog: 11q23.2

Cellular Component: synaptic vesicle; basolateral plasma membrane; axon; dendrite; integral to membrane; plasma membrane; intercellular junction

Molecular Function: protein binding; protein homodimerization activity; cell adhesion molecule binding; receptor binding; PDZ domain binding

Biological Process: unidimensional cell growth; intercellular junction assembly and maintenance; apoptosis; activated T cell proliferation; cell recognition; susceptibility to natural killer cell mediated cytotoxicity; positive regulation of natural killer cell mediated cytotoxicity; liver development; calcium-independent cell-cell adhesion; heterophilic cell adhesion; synaptogenesis; detection of stimulus; spermatogenesis; brain development; homophilic cell adhesion; cell differentiation; T cell mediated cytotoxicity; positive regulation of cytokine secretion

Research Articles on CADM1

Similar Products

Product Notes

The CADM1 cadm1 (Catalog #AAA6216107) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CADM1 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CADM1 cadm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CADM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.