Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human Cadherin N Monoclonal Antibody | anti-CDHN antibody

Cadherin N (Neural Cadherin, N-Cadherin, CDHN, NCAD, Cadherin 2 Type 1 N-Cadherin (Neuronal), Cadherin-2, CDH2, CD325, CD325 Antigen, CDw325) (PE)

Gene Names
CDH2; CDHN; NCAD; CD325; CDw325
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cadherin N; Monoclonal Antibody; Cadherin N (Neural Cadherin; N-Cadherin; CDHN; NCAD; Cadherin 2 Type 1 N-Cadherin (Neuronal); Cadherin-2; CDH2; CD325; CD325 Antigen; CDw325) (PE); anti-CDHN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5C8
Specificity
Recognizes human CDH2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CDHN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa807-906 from human CDH2 (NP_001783) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged CDH2 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDH2 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-CDHN antibody
Cadherin-2 or Neural Cadherin is a member of the cadherin family of proteins that mediate calcium ion-dependent cell adhesion. Other members include E-cadherin and P-cadherin. Cadherin-2 is expressed in the brain and skeletal and cardiac muscle. Cadherin-2 has been identified as a potential prognostic marker for a number of tumors.
Product Categories/Family for anti-CDHN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62.9kDa (574aa) 70-100kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
cadherin-2 isoform 1 preproprotein
NCBI Official Synonym Full Names
cadherin 2
NCBI Official Symbol
CDH2
NCBI Official Synonym Symbols
CDHN; NCAD; CD325; CDw325
NCBI Protein Information
cadherin-2
UniProt Protein Name
Cadherin-2
UniProt Gene Name
CDH2
UniProt Synonym Gene Names
CDHN; NCAD; N-cadherin
UniProt Entry Name
CADH2_HUMAN

NCBI Description

This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone. [provided by RefSeq, Nov 2015]

Uniprot Description

CDH2: Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH2 may be involved in neuronal recognition mechanism. In hippocampal neurons, may regulate dendritic spine density. Interacts with CDCP1. Identified in a complex containing FGFR4, NCAM1, CDH2, PLCG1, FRS2, SRC, SHC1, GAP43 and CTTN. Interacts with PCDH8; this complex may also include TAOK2. The interaction with PCDH8 may lead to internalization through TAOK2/p38 MAPK pathway.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 18q11.2

Cellular Component: cell-cell adherens junction; focal adhesion; lamellipodium; apical plasma membrane; integral to membrane; plasma membrane; synapse; intercellular junction; fascia adherens; catenin complex

Molecular Function: protein binding; gamma-catenin binding; beta-catenin binding; calcium ion binding; protein phosphatase binding; alpha-catenin binding

Biological Process: heterophilic cell adhesion; intercellular junction assembly and maintenance; muscle cell differentiation; cell migration; glial cell differentiation; positive regulation of MAPKKK cascade; calcium-dependent cell-cell adhesion; blood vessel morphogenesis; positive regulation of muscle cell differentiation; striated muscle cell differentiation; cell adhesion; homophilic cell adhesion

Research Articles on CDHN

Similar Products

Product Notes

The CDHN cdh2 (Catalog #AAA6156838) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cadherin N (Neural Cadherin, N-Cadherin, CDHN, NCAD, Cadherin 2 Type 1 N-Cadherin (Neuronal), Cadherin-2, CDH2, CD325, CD325 Antigen, CDw325) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cadherin N can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDHN cdh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cadherin N, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.