Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CA8 monoclonal antibody, Western Blot analysis of CA8 expression in A-549.)

Mouse anti-Human CA8 Monoclonal Antibody | anti-CA8 antibody

CA8 (Carbonic Anhydrase-related Protein, CARP, Carbonic Anhydrase VIII, CA-VIII, CALS) (PE)

Gene Names
CA8; CALS; CARP; CA-RP; CAMRQ3; CA-VIII
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CA8; Monoclonal Antibody; CA8 (Carbonic Anhydrase-related Protein; CARP; Carbonic Anhydrase VIII; CA-VIII; CALS) (PE); anti-CA8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1F7
Specificity
Recognizes human CA8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CA8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa40-139 from human CA8 (NP_004047) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPME
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CA8 monoclonal antibody, Western Blot analysis of CA8 expression in A-549.)

Western Blot (WB) (CA8 monoclonal antibody, Western Blot analysis of CA8 expression in A-549.)

Testing Data

(Detection limit for recombinant GST tagged CA8 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CA8 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-CA8 antibody
Does not have a carbonic anhydrase catalytic activity.
Product Categories/Family for anti-CA8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
767
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.5 kDa (314aa) confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
NCBI Official Full Name
carbonic anhydrase-related protein isoform a
NCBI Official Synonym Full Names
carbonic anhydrase 8
NCBI Official Symbol
CA8
NCBI Official Synonym Symbols
CALS; CARP; CA-RP; CAMRQ3; CA-VIII
NCBI Protein Information
carbonic anhydrase-related protein
UniProt Protein Name
Carbonic anhydrase-related protein
UniProt Gene Name
CA8
UniProt Synonym Gene Names
CALS; CARP; CA-VIII
UniProt Entry Name
CAH8_HUMAN

NCBI Description

The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. Mutations in this gene are associated with cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3). Polymorphisms in this gene are associated with osteoporosis, and overexpression of this gene in osteosarcoma cells suggests an oncogenic role. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

CA8: Does not have a carbonic anhydrase catalytic activity. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3). CMARQ3 is a congenital cerebellar ataxia associated with dysarthia, quadrupedal gait and mild mental retardation. Belongs to the alpha-carbonic anhydrase family.

Protein type: Energy Metabolism - nitrogen; Lyase

Chromosomal Location of Human Ortholog: 8q12.1

Cellular Component: cytoplasm

Molecular Function: carbonate dehydratase activity; zinc ion binding

Biological Process: phosphoinositide-mediated signaling; one-carbon compound metabolic process

Disease: Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 3

Research Articles on CA8

Similar Products

Product Notes

The CA8 ca8 (Catalog #AAA6156823) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CA8 (Carbonic Anhydrase-related Protein, CARP, Carbonic Anhydrase VIII, CA-VIII, CALS) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CA8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CA8 ca8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CA8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.