Mouse anti-Human CA3 Monoclonal Antibody | anti-CA3 antibody

CA3 (Carbonic Anhydrase 3, Carbonic Anhydrase III, CA-III, Carbonate Dehydratase III) (Biotin)

Cat. Num. AAA6140909

• Gene Names: CA3; Car3; CAIII
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CA3; Monoclonal Antibody; CA3 (Carbonic Anhydrase 3; Carbonic Anhydrase III; CA-III; Carbonate Dehydratase III) (Biotin); anti-CA3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4A12-1A3
• Specificity: Recognizes human CA3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CA3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-260 from human CA3 (AAH04897) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (54.34kD).)

Western Blot (WB)

(CA3 monoclonal antibody, Western Blot analysis of CA3 expression in K-562.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CA3 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-CA3 antibody

Antibodies; Enzymes

References

1. Proteomic profiling of antisense-induced exon skipping reveals reversal of pathobiochemical abnormalities in dystrophic mdx diaphragm. Doran P, Wilton SD, Fletcher S, Ohlendieck K.Proteomics. 2009 Feb;9(3):671-85.

NCBI and Uniprot Product Information

• NCBI GI #: 38114606
• NCBI GeneID: 761
• Molecular Weight: 29,557 Da
• NCBI Official Full Name: Homo sapiens carbonic anhydrase III, muscle specific, mRNA
• NCBI Official Synonym Full Names: carbonic anhydrase 3
• NCBI Official Symbol: CA3
• NCBI Official Synonym Symbols: Car3; CAIII
• NCBI Protein Information: carbonic anhydrase 3
• Protein Family: Carbonic anhydrase

NCBI Description

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns. [provided by RefSeq, Oct 2008]