Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human C8orf1 Monoclonal Antibody | anti-OSGIN2 antibody

C8orf1 (Oxidative Stress-induced Growth Inhibitor 2, hT41, OSGIN2)

Gene Names
OSGIN2; hT41; C8orf1
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
C8orf1; Monoclonal Antibody; C8orf1 (Oxidative Stress-induced Growth Inhibitor 2; hT41; OSGIN2); Anti -C8orf1 (Oxidative Stress-induced Growth Inhibitor 2; anti-OSGIN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E11
Specificity
Recognizes human C8orf1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGGDGIA
Applicable Applications for anti-OSGIN2 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa398-505 from human C8orf1 (AAH31054) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-OSGIN2 antibody
May be involved in meiosis or the maturation of germ cells.
Product Categories/Family for anti-OSGIN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
734
UniProt Accession #
Molecular Weight
56,672 Da
NCBI Official Full Name
chromosome 8 open reading frame 1, isoform CRA_a
NCBI Official Synonym Full Names
oxidative stress induced growth inhibitor family member 2
NCBI Official Symbol
OSGIN2
NCBI Official Synonym Symbols
hT41; C8orf1
NCBI Protein Information
oxidative stress-induced growth inhibitor 2
UniProt Protein Name
Oxidative stress-induced growth inhibitor 2
UniProt Gene Name
OSGIN2
UniProt Synonym Gene Names
C8orf1
UniProt Entry Name
OSGI2_HUMAN

Uniprot Description

OSGIN2: May be involved in meiosis or the maturation of germ cells. Belongs to the OKL38 family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 8q21

Biological Process: meiotic cell cycle

Similar Products

Product Notes

The OSGIN2 osgin2 (Catalog #AAA6005500) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C8orf1 (Oxidative Stress-induced Growth Inhibitor 2, hT41, OSGIN2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C8orf1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the OSGIN2 osgin2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SGLKKIFKLS AAVVLIGSHP NLSFLKDQGC YLGHKSSQPI TCKGNPVEID TYTYECIKEA NLFALGPLVG DNFVRFLKGG ALGVTRCLAT RQKKKHLFVE RGGGDGIA. It is sometimes possible for the material contained within the vial of "C8orf1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.