Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cytosolic beta-glucosidase (GBA3) Recombinant Protein | GBA3 recombinant protein

Recombinant Human Cytosolic beta-glucosidase (GBA3)

Gene Names
GBA3; CBG; GLUC; KLRP; CBGL1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytosolic beta-glucosidase (GBA3); Recombinant Human Cytosolic beta-glucosidase (GBA3); Cytosolic beta-glucosidase; EC=3.2.1.21; Cytosolic beta-glucosidase-like protein 1; GBA3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-162aa; Full Length of Isoform 2
Sequence
MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL
Sequence Length
469
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for GBA3 recombinant protein
Glycosidase probably involved in the intestinal absorption and metabolism of dietary flavonoid glycosides. Able to hydrolyze a broad variety of glycosides including phytoestrogens, flavonols, flavones, flavanones and cyanogens. Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide.
Product Categories/Family for GBA3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45.3 kDa
NCBI Official Full Name
cytosolic beta-glucosidase isoform b
NCBI Official Synonym Full Names
glucosidase, beta, acid 3
NCBI Official Symbol
GBA3
NCBI Official Synonym Symbols
CBG; GLUC; KLRP; CBGL1
NCBI Protein Information
cytosolic beta-glucosidase; klotho-related protein; glucosidase, beta, acid 3 (cytosolic); cytosolic beta-glucosidase-like protein 1
UniProt Protein Name
Cytosolic beta-glucosidase
UniProt Gene Name
GBA3
UniProt Synonym Gene Names
CBG; CBGL1
UniProt Entry Name
GBA3_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that can hydrolyze several types of glycosides. This gene is a polymorphic pseudogene, with the most common allele being the functional allele that encodes the full-length protein. Some individuals, as represented by the reference genome allele, contain a single nucleotide polymorphism that results in a premature stop codon in the coding region, and therefore this allele is pseudogenic due to the failure to produce a functional full-length protein. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Mar 2013]

Uniprot Description

GBA3: Glycosidase probably involved in the intestinal absorption and metabolism of dietary flavonoid glycosides. Able to hydrolyze a broad variety of glycosides including phytoestrogens, flavonols, flavones, flavanones and cyanogens. Possesses beta- glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide. Belongs to the glycosyl hydrolase 1 family. Klotho subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Carbohydrate Metabolism - starch and sucrose; Other Amino Acids Metabolism - cyanoamino acid; EC 3.2.1.21

Chromosomal Location of Human Ortholog: 4p15.2

Cellular Component: cytosol

Molecular Function: beta-glucosidase activity; beta-galactosidase activity; glycosylceramidase activity

Biological Process: sphingolipid metabolic process; glycoside catabolic process; carbohydrate metabolic process; glycosylceramide catabolic process; glycosphingolipid metabolic process

Research Articles on GBA3

Similar Products

Product Notes

The GBA3 gba3 (Catalog #AAA1383878) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-162aa; Full Length of Isoform 2. The amino acid sequence is listed below: MAFPAGFGWA AATAAYQVEG GWDADGKGPC VWDTFTHQGG ERVFKNQTGD VACGSYTLWE EDLKCIKQLG LTHYRFSLSW SRLLPDGTTG FINQKAIQLD KVNLQVYCAW SLLDNFEWNQ GYSSRFGLFH VDFEDPARPR VPYTSAKEYA KIIRNNGLEA HL. It is sometimes possible for the material contained within the vial of "Cytosolic beta-glucosidase (GBA3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.