Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human C4orf6 Monoclonal Antibody | anti-C4orf6 antibody

C4orf6 (AC1, Uncharacterized Protein C4orf6, Protein AC1)

Gene Names
C4orf6; aC1
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
C4orf6; Monoclonal Antibody; C4orf6 (AC1; Uncharacterized Protein C4orf6; Protein AC1); Anti -C4orf6 (AC1; anti-C4orf6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F12
Specificity
Recognizes human C4orf6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADTADKTEPECFAASWTFDPNPSVTVSGAHSTAVHQ
Applicable Applications for anti-C4orf6 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa1-93 from C4orf6 (NP_00574 1) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-C4orf6 antibody
The unprocessed precursor of protein AC1 has a length of 93aa and an estimated molecular weight of ~10.5KD. This protein is expressed in neuroblastoma but its function is undetermined.
Product Categories/Family for anti-C4orf6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
10,499 Da
NCBI Official Full Name
chromosome 4 open reading frame 6
NCBI Official Synonym Full Names
chromosome 4 open reading frame 6
NCBI Official Symbol
C4orf6
NCBI Official Synonym Symbols
aC1
NCBI Protein Information
uncharacterized protein C4orf6; expressed in neuroblastoma
UniProt Protein Name
Uncharacterized protein C4orf6
UniProt Gene Name
C4orf6
UniProt Synonym Gene Names
AC1
UniProt Entry Name
CD006_HUMAN

NCBI Description

This gene is expressed in neuroblastoma; however, the function of this gene is not yet determined. [provided by RefSeq, Jul 2008]

Uniprot Description

C4orf6:

Chromosomal Location of Human Ortholog: 4p16.2

Biological Process: nervous system development

Research Articles on C4orf6

Similar Products

Product Notes

The C4orf6 c4orf6 (Catalog #AAA6004388) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C4orf6 (AC1, Uncharacterized Protein C4orf6, Protein AC1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C4orf6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the C4orf6 c4orf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDTQKQIHKT HNSKNQFFTI FFFLSVEFGK EGTRKNFYLL LSIGHYGRKS RRADLGTADT ADKTEPECFA ASWTFDPNPS VTVSGAHSTA VHQ. It is sometimes possible for the material contained within the vial of "C4orf6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.