Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human C21orf2 Monoclonal Antibody | anti-C21orf2 antibody

C21orf2 (Protein C21orf2, C21orf-HUMF09G8.5, YF5/A2) (HRP)

Gene Names
CFAP410; RDMS; SMDAX; LRRC76; YF5/A2; C21orf2
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
C21orf2; Monoclonal Antibody; C21orf2 (Protein C21orf2; C21orf-HUMF09G8.5; YF5/A2) (HRP); anti-C21orf2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E4
Specificity
Recognizes human C21orf2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-C21orf2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human C21orf2 (NP_004919) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNSISTLEPVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-C21orf2 antibody
May play roles in cilia formation and/or maintenance. Plays a role in the regulation of cell morphology and cytoskeletal organization.
Product Categories/Family for anti-C21orf2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
755
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
nuclear encoded mitochondrial protein C21orf2 isoform 1
NCBI Official Synonym Full Names
cilia and flagella associated protein 410
NCBI Official Symbol
CFAP410
NCBI Official Synonym Symbols
RDMS; SMDAX; LRRC76; YF5/A2; C21orf2
NCBI Protein Information
cilia- and flagella-associated protein 410; nuclear encoded mitochondrial protein C21orf2
UniProt Protein Name
Protein C21orf2
Protein Family
UniProt Gene Name
C21orf2
UniProt Entry Name
CU002_HUMAN

NCBI Description

Four alternatively spliced transcript variants encoding four different isoforms have been found for this nuclear gene. All isoforms contain leucine-rich repeats. Three of these isoforms are mitochondrial proteins and one of them lacks the target peptide, so is not located in mitochondrion. This gene is down-regulated in Down syndrome (DS) brain, which may represent mitochondrial dysfunction in DS patients. [provided by RefSeq, Sep 2012]

Research Articles on C21orf2

Similar Products

Product Notes

The C21orf2 c21orf2 (Catalog #AAA6151494) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C21orf2 (Protein C21orf2, C21orf-HUMF09G8.5, YF5/A2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C21orf2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C21orf2 c21orf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C21orf2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.