Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: C21orf2Sample Type: THP-1 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CFAP410 Polyclonal Antibody | anti-CFAP410 antibody

CFAP410 Antibody - C-terminal region

Gene Names
CFAP410; RDMS; SMDAX; LRRC76; YF5/A2; C21orf2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CFAP410; Polyclonal Antibody; CFAP410 Antibody - C-terminal region; anti-CFAP410 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL
Sequence Length
215
Applicable Applications for anti-CFAP410 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C21orf2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: C21orf2Sample Type: THP-1 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: C21orf2Sample Type: THP-1 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CFAP410 antibody
This is a rabbit polyclonal antibody against C21orf2. It was validated on Western Blot

Target Description: Four alternatively spliced transcript variants encoding four different isoforms have been found for this nuclear gene. All isoforms contain leucine-rich repeats. Three of these isoforms are mitochondrial proteins and one of them lacks the target peptide, so is not located in mitochondrion. This gene is down-regulated in Down syndrome (DS) brain, which may represent mitochondrial dysfunction in DS patients.
Product Categories/Family for anti-CFAP410 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
755
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
nuclear encoded mitochondrial protein C21orf2 isoform 1
NCBI Official Synonym Full Names
cilia and flagella associated protein 410
NCBI Official Symbol
CFAP410
NCBI Official Synonym Symbols
RDMS; SMDAX; LRRC76; YF5/A2; C21orf2
NCBI Protein Information
cilia- and flagella-associated protein 410; nuclear encoded mitochondrial protein C21orf2
UniProt Protein Name
Protein C21orf2
UniProt Gene Name
C21orf2
UniProt Entry Name
CU002_HUMAN

NCBI Description

Four alternatively spliced transcript variants encoding four different isoforms have been found for this nuclear gene. All isoforms contain leucine-rich repeats. Three of these isoforms are mitochondrial proteins and one of them lacks the target peptide, so is not located in mitochondrion. This gene is down-regulated in Down syndrome (DS) brain, which may represent mitochondrial dysfunction in DS patients. [provided by RefSeq, Sep 2012]

Research Articles on CFAP410

Similar Products

Product Notes

The CFAP410 c21orf2 (Catalog #AAA3207931) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CFAP410 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CFAP410 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CFAP410 c21orf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPLDSEEEAT SGAQDERGLK PPSRGQFPSL SARDASSSHR GRNVLTAILL. It is sometimes possible for the material contained within the vial of "CFAP410, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.