Mouse anti-Human BTN2A1 Monoclonal Antibody | anti-BTN2A1 antibody

BTN2A1 (Butyrophilin Subfamily 2 Member A1, BT2.1, BTF1) APC

Cat. Num. AAA6135565

• Gene Names: BTN2A1; BTF1; BT2.1; BTN2.1; DJ3E1.1; BK14H9.1
• Reactivity: Human
• Applications: FLISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BTN2A1; Monoclonal Antibody; BTN2A1 (Butyrophilin Subfamily 2 Member A1; BT2.1; BTF1) APC; anti-BTN2A1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A1
• Specificity: Recognizes human BTN2A1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-BTN2A1 antibody: FLISA
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-334 from human BTN2A1 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged BTN2A1 is ~1ng/ml using MBS645339 as a capture antibody.)

Related Product Information for anti-BTN2A1 antibody

The MHC-encoded butyrophilin, BTN2A1, is a cell surface glycoprotein related to the extended family of B7 costimulatory molecules. BTN2A1 mRNA is expressed in most human tissues, but protein expression is significantly lower in leukocytes. The protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism. Recent studies reveal that the protein can negatively regulate T cell proliferation and cytokine production. Additionally, genetic studies have described polymorphisms in the protein which are reported to be associated with disorders such as sarcoidosis, myositis andulcerative colitis. Human BTN2A1 gene is located in 6p22.1.

Product Categories/Family for anti-BTN2A1 antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16741729
• NCBI GeneID: 11120
• Molecular Weight: 37,240 Da
• NCBI Official Full Name: Homo sapiens butyrophilin, subfamily 2, member A1, mRNA
• NCBI Official Synonym Full Names: butyrophilin subfamily 2 member A1
• NCBI Official Symbol: BTN2A1
• NCBI Official Synonym Symbols: BTF1; BT2.1; BTN2.1; DJ3E1.1; BK14H9.1
• NCBI Protein Information: butyrophilin subfamily 2 member A1
• Protein Family: Butyrophilin subfamily

NCBI Description

This gene encodes a member of the immunoglobulin superfamily. The gene is located in a cluster of butyrophilin-like genes in the juxta-telomeric region of the major histocompatibility complex on chromosome 6. A pseudogene of this gene has been identified in this cluster. The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations in this gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2013]