Mouse anti-Human BTN2A1 Monoclonal Antibody | anti-BTN2A1 antibody

BTN2A1 (Butyrophilin Subfamily 2 Member A1, BT2.1, BTF1)

Cat. Num. AAA645339

• Gene Names: BTN2A1; BTF1; BT2.1; DJ3E1.1; BK14H9.1
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: BTN2A1; Monoclonal Antibody; BTN2A1 (Butyrophilin Subfamily 2 Member A1; BT2.1; BTF1); Anti -BTN2A1 (Butyrophilin Subfamily 2 Member A1; anti-BTN2A1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A1
• Specificity: Recognizes human BTN2A1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN

• Applicable Applications for anti-BTN2A1 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.; Dilution: Sandwich ELISA: The detection limit for recombinant GST tagged BTN2A1 is ~1ng/ml as a capture antibody.
• Immunogen: Full length recombinant corresponding to aa1-335 from human BTN2A1 (AAH16661) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged BTN2A1 is ~1ng/ml using MBS645339 as a capture antibody.)

Related Product Information for anti-BTN2A1 antibody

The MHC-encoded butyrophilin, BTN2A1, is a cell surface glycoprotein related to the extended family of B7 costimulatory molecules. BTN2A1 mRNA is expressed in most human tissues, but protein expression is significantly lower in leukocytes. The protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism. Recent studies reveal that the protein can negatively regulate T cell proliferation and cytokine production. Additionally, genetic studies have described polymorphisms in the protein which are reported to be associated with disorders such as sarcoidosis, myositis andulcerative colitis. Human BTN2A1 gene is located in 6p22.1.

Product Categories/Family for anti-BTN2A1 antibody

Antibodies; Abs to Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 308522730
• NCBI GeneID: 11120
• NCBI Accession #: NP_001184163.1
• NCBI GenBank Nucleotide #: NM_001197234.2
• UniProt Accession #: Q7KYR7; O00475; P78408; Q59EN4; Q7KYQ7; Q7Z386; Q96AV7; Q9NU62; B4DLP9; E9PGR4
• Molecular Weight: 59,633 Da
• NCBI Official Full Name: butyrophilin subfamily 2 member A1 isoform 4
• NCBI Official Synonym Full Names: butyrophilin, subfamily 2, member A1
• NCBI Official Symbol: BTN2A1
• NCBI Official Synonym Symbols: BTF1; BT2.1; DJ3E1.1; BK14H9.1
• NCBI Protein Information: butyrophilin subfamily 2 member A1
• UniProt Protein Name: Butyrophilin subfamily 2 member A1
• Protein Family: Butyrophilin subfamily
• UniProt Gene Name: BTN2A1
• UniProt Synonym Gene Names: BT2.1; BTF1
• UniProt Entry Name: BT2A1_HUMAN

NCBI Description

This gene encodes a member of the immunoglobulin superfamily. The gene is located in a cluster of butyrophilin-like genes in the juxta-telomeric region of the major histocompatibility complex on chromosome 6. A pseudogene of this gene has been identified in this cluster. The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations in this gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

BTN2A1: a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: integral to plasma membrane

Biological Process: lipid metabolic process