Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human HPD Monoclonal Antibody | anti-HPD antibody

HPD (4-Hydroxyphenylpyruvate Dioxygenase, 4-hydroxyphenylpyruvic Acid Oxidase, 4HPPD, 4-HPPD, HPPDase, GLOD3, PPD) APC

Gene Names
HPD; PPD; 4HPPD; GLOD3; 4-HPPD; HPPDASE
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HPD; Monoclonal Antibody; HPD (4-Hydroxyphenylpyruvate Dioxygenase; 4-hydroxyphenylpyruvic Acid Oxidase; 4HPPD; 4-HPPD; HPPDase; GLOD3; PPD) APC; anti-HPD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F3
Specificity
Recognizes human HPD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
393
Applicable Applications for anti-HPD antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa160-269 from human HPD (NP_002141.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIAL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(HPD monoclonal antibody Western Blot analysis of HPD expression in HeLa.)

Western Blot (WB) (HPD monoclonal antibody Western Blot analysis of HPD expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged HPD is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HPD is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-HPD antibody
HPD is an enzyme in the catabolic pathway of tyrosine. This protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate.
Product Categories/Family for anti-HPD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
4-hydroxyphenylpyruvate dioxygenase isoform 1
NCBI Official Synonym Full Names
4-hydroxyphenylpyruvate dioxygenase
NCBI Official Symbol
HPD
NCBI Official Synonym Symbols
PPD; 4HPPD; GLOD3; 4-HPPD; HPPDASE
NCBI Protein Information
4-hydroxyphenylpyruvate dioxygenase
UniProt Protein Name
4-hydroxyphenylpyruvate dioxygenase
UniProt Gene Name
HPD
UniProt Synonym Gene Names
PPD; 4HPPD; HPD; HPPDase
UniProt Entry Name
HPPD_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria (HAWK). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

HPD: Key enzyme in the degradation of tyrosine. Defects in HPD are the cause of tyrosinemia type 3 (TYRO3). TYRO3 is an inborn error of metabolism characterized by elevations of tyrosine in the blood and urine, seizures and mild mental retardation. Defects in HPD are a cause of hawkinsinuria (HAWK). HAWK is an inborn error of tyrosine metabolism characterized by failure to thrive, persistent metabolic acidosis, fine and sparse hair, and excretion of the unusual cyclic amino acid metabolite, hawkinsin, in the urine. Belongs to the 4HPPD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.13.11.27; Cofactor and Vitamin Metabolism - ubiquinone and other terpenoid-quinone biosynthesis; Amino Acid Metabolism - phenylalanine; Oxidoreductase; Amino Acid Metabolism - tyrosine

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: cytosol

Molecular Function: 4-hydroxyphenylpyruvate dioxygenase activity; metal ion binding

Biological Process: L-phenylalanine catabolic process; tyrosine catabolic process

Disease: Hawkinsinuria; Tyrosinemia, Type Iii

Research Articles on HPD

Similar Products

Product Notes

The HPD hpd (Catalog #AAA6137045) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HPD (4-Hydroxyphenylpyruvate Dioxygenase, 4-hydroxyphenylpyruvic Acid Oxidase, 4HPPD, 4-HPPD, HPPDase, GLOD3, PPD) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HPD can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HPD hpd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HPD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.