Mouse anti-Human Brain Natriuretic Peptide, aa1-32 Monoclonal Antibody
Brain Natriuretic Peptide, aa1-32 (BNP)
Reactivity
Human
Applications
ELISA
Purity
Affinity PurifiedPurified by Protein G affinity chromatography.
Synonyms
Brain Natriuretic Peptide; aa1-32; Monoclonal Antibody; aa1-32 (BNP); Anti -Brain Natriuretic Peptide; anti-Brain Natriuretic Peptide; aa1-32 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
21-46
Specificity
Recognizes human Brain Natriuretic Peptide (aa 1-32)
Purity/Purification
Affinity Purified
Purified by Protein G affinity chromatography.
Purified by Protein G affinity chromatography.
Form/Format
Supplied as a lyophilized powder in PBS, pH 7.2. Reconstitute in ddH2O.
Applicable Applications for anti-Brain Natriuretic Peptide, aa1-32 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
Preparation and Storage
Lyophilized powder may be stored at 4 degree C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20 degree C. Reconstituted product is stable for 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for anti-Brain Natriuretic Peptide, aa1-32 antibody
Human brain natriuretic peptide (BNP) is a secreted protein which is a member of the natriuretic peptide family. BNP is a cardiac hormone, which is synthesized as a pro-hormone (proBNP), and is proteolytically cleaved to release a biologically active fragment (BNP), and an inactive fragment (NT-proBNP) into the circulation.
BNP is predominantly secreted from the cardiac ventricles in response to volume and pressure overload, and results in a number of biological activities including natriuresis, diuresis, vasorelaxation, and inhibition of the sympathetic nervous system. A high concentration of BNP in the bloodstream is indicative of heart failure.
BNP is predominantly secreted from the cardiac ventricles in response to volume and pressure overload, and results in a number of biological activities including natriuresis, diuresis, vasorelaxation, and inhibition of the sympathetic nervous system. A high concentration of BNP in the bloodstream is indicative of heart failure.
Product Categories/Family for anti-Brain Natriuretic Peptide, aa1-32 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
brain natriuretic peptide
NCBI Description
This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq, Nov 2014]
Similar Products
Product Notes
The Brain Natriuretic Peptide, aa1-32 (Catalog #AAA644469) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Brain Natriuretic Peptide, aa1-32 (BNP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Brain Natriuretic Peptide, aa1-32 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the Brain Natriuretic Peptide, aa1-32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Brain Natriuretic Peptide, aa1-32, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
