Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged BRAF is 0.3 ng/ml as a capture antibody.)

Mouse BRAF Monoclonal Antibody | anti-BRAF antibody

BRAF (v-raf murine Sarcoma Viral Oncogene Homolog B1, B-RAF1, BRAF1, FLJ95109, MGC126806, MGC138284, RAFB1) (APC)

Gene Names
BRAF; NS7; B-raf; BRAF1; RAFB1; B-RAF1
Applications
Western Blot
Purity
Purified
Synonyms
BRAF; Monoclonal Antibody; BRAF (v-raf murine Sarcoma Viral Oncogene Homolog B1; B-RAF1; BRAF1; FLJ95109; MGC126806; MGC138284; RAFB1) (APC); v-raf murine Sarcoma Viral Oncogene Homolog B1; RAFB1; anti-BRAF antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F4
Specificity
Recognizes BRAF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-BRAF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BRAF (NP_004324, 138aa-231aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged BRAF is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BRAF is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-BRAF antibody
This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene. [provided by RefSeq]
Product Categories/Family for anti-BRAF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
673
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40.6 kDa (360aa)
NCBI Official Full Name
serine/threonine-protein kinase B-raf isoform 1
NCBI Official Synonym Full Names
B-Raf proto-oncogene, serine/threonine kinase
NCBI Official Symbol
BRAF
NCBI Official Synonym Symbols
NS7; B-raf; BRAF1; RAFB1; B-RAF1
NCBI Protein Information
serine/threonine-protein kinase B-raf
UniProt Protein Name
Serine/threonine-protein kinase B-raf
UniProt Gene Name
BRAF
UniProt Synonym Gene Names
BRAF1; RAFB1
UniProt Entry Name
BRAF_HUMAN

NCBI Description

This gene encodes a protein belonging to the RAF family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERK signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene, most commonly the V600E mutation, are the most frequently identified cancer-causing mutations in melanoma, and have been identified in various other cancers as well, including non-Hodgkin lymphoma, colorectal cancer, thyroid carcinoma, non-small cell lung carcinoma, hairy cell leukemia and adenocarcinoma of lung. Mutations in this gene are also associated with cardiofaciocutaneous, Noonan, and Costello syndromes, which exhibit overlapping phenotypes. A pseudogene of this gene has been identified on the X chromosome. [provided by RefSeq, Aug 2017]

Uniprot Description

BRAF: a tyrosine kinase-like kinase of the RAF family. Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May play a role in the postsynaptic responses of hippocampal neuron. Frequently mutated in thyroid cancers, skin melanomas and at lower frequency in a wide range of human cancers. An activating mutation, mimicking phosphorylation of the activation loop, is seen in 60% of malignant melanoma samples. Raf mutations are generally exclusive to Ras activating mutations. Activating mutations are also seen in ~10% of colorectal cancers, in lung cancers and gliomas, and at a lower rate in several other tumors. Inactivating mutations are also seen and may result in activation of c-Raf and Erk. Mutations in B-Raf, MEK1 and MEK2 also associated with cardiofaciocutaneous syndrome, displaying morphological, cardiac and mental defects. Approved Inhibitor: Nexavar/Sorafenib.

Protein type: Protein kinase, TKL; Kinase, protein; Oncoprotein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; TKL group; RAF family

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: neuron projection; mitochondrion; plasma membrane; cytosol; nucleus

Molecular Function: small GTPase binding; identical protein binding; protein serine/threonine kinase activity; protein binding; MAP kinase kinase kinase activity; mitogen-activated protein kinase kinase binding; protein heterodimerization activity; calcium ion binding; ATP binding; protein kinase activity

Biological Process: response to peptide hormone stimulus; positive T cell selection; response to cAMP; fibroblast growth factor receptor signaling pathway; CD4-positive, alpha beta T cell differentiation; nerve growth factor receptor signaling pathway; activation of MAPKK activity; protein heterooligomerization; somatic stem cell maintenance; MAPKKK cascade; protein amino acid phosphorylation; positive regulation of peptidyl-serine phosphorylation; regulation of cell proliferation; synaptic transmission; organ morphogenesis; myeloid progenitor cell differentiation; small GTPase mediated signal transduction; positive regulation of stress fiber formation; visual learning; negative regulation of neuron apoptosis; negative regulation of apoptosis

Disease: Noonan Syndrome 1; Noonan Syndrome 7; Lung Cancer; Leopard Syndrome 3; Cardiofaciocutaneous Syndrome 1

Research Articles on BRAF

Similar Products

Product Notes

The BRAF braf (Catalog #AAA6167123) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BRAF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BRAF braf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BRAF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.