Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human BNIP3L Monoclonal Antibody | anti-BNIP3L antibody

BNIP3L (BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3-like, Adenovirus E1B19K-Binding Protein B5, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3A, NIP3-like Protein X, NIP3L, BNIP3A, BNIP3H, NIX) (MaxLight 650)

Gene Names
BNIP3L; NIX; BNIP3a
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BNIP3L; Monoclonal Antibody; BNIP3L (BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3-like; Adenovirus E1B19K-Binding Protein B5; BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3A; NIP3-like Protein X; NIP3L; BNIP3A; BNIP3H; NIX) (MaxLight 650); anti-BNIP3L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G2
Specificity
Recognizes human BNIP3L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-BNIP3L antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa43-130 from human BNIP3L (NP_004322) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-BNIP3L antibody
References
1. Identification of 14-3-3?^ as a Mieap-interacting protein and its role in mitochondrial quality control. Miyamoto T, Kitamura N, Ono M, Nakamura Y, Yoshida M, Kamino H, Murai R, Yamada T, Arakawa H.Sci Rep. 2012;2:379. Epub 2012 Apr 24. 2. BNIP3 and NIX Mediate Mieap-Induced Accumulation of Lysosomal Proteins within Mitochondria. Nakamura Y, Kitamura N, Shinogi D, Yoshida M, Goda O, Murai R, Kamino H, Arakawa H.PLoS One. 2012;7(1):e30767. Epub 2012 Jan 26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
665
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,559 Da
NCBI Official Full Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
NCBI Official Synonym Full Names
BCL2/adenovirus E1B 19kDa interacting protein 3-like
NCBI Official Symbol
BNIP3L
NCBI Official Synonym Symbols
NIX; BNIP3a
NCBI Protein Information
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A; BCL2/adenovirus E1B 19-kd protein-interacting protein 3a; NIP3-like protein X; NIP3L; adenovirus E1B19k-binding protein B5
UniProt Protein Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
UniProt Gene Name
BNIP3L
UniProt Synonym Gene Names
BNIP3A; BNIP3H; NIX; NIP3L
UniProt Entry Name
BNI3L_HUMAN

Uniprot Description

BNIP3L: Induces apoptosis. Interacts with viral and cellular anti-apoptosis proteins. Can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. Inhibits apoptosis induced by BNIP3. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates to mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. May function as a tumor suppressor. Self-associates. Interacts with BNIP3 and STEAP3. Interacts with SPATA18/MIEAP. Interacts with human adenovirus-2 E1B 19 kDa protein. Belongs to the NIP3 family.

Protein type: Apoptosis; Membrane protein, integral; Mitochondrial; Endoplasmic reticulum; Nuclear envelope

Chromosomal Location of Human Ortholog: 8p21

Cellular Component: mitochondrial outer membrane; mitochondrion; endoplasmic reticulum; integral to membrane; nuclear envelope; intrinsic to membrane

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; protein heterodimerization activity; lamin binding

Biological Process: viral reproduction; positive regulation of apoptosis; defense response to virus; negative regulation of apoptosis

Similar Products

Product Notes

The BNIP3L bnip3l (Catalog #AAA6221126) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BNIP3L (BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3-like, Adenovirus E1B19K-Binding Protein B5, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3A, NIP3-like Protein X, NIP3L, BNIP3A, BNIP3H, NIX) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BNIP3L can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BNIP3L bnip3l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BNIP3L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.