Mouse anti-Human BMX Monoclonal Antibody | anti-BMX antibody

BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X Protein, ETK, Epithelial and Endothelial Tyrosine Kinase, NTK38) APC

Cat. Num. AAA6135538

• Gene Names: BMX; ETK; PSCTK2; PSCTK3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BMX; Monoclonal Antibody; BMX (Cytoplasmic Tyrosine-protein Kinase BMX; Bone Marrow Tyrosine Kinase Gene in Chromosome X Protein; ETK; Epithelial and Endothelial Tyrosine Kinase; NTK38) APC; anti-BMX antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G3
• Specificity: Recognizes human BMX.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-BMX antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa150-280 from human BMX (AAH16652) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.15kD).)

Related Product Information for anti-BMX antibody

Etk is a member of the Bruton's tyrosine kinase family. Etk is expressed in a variety of hematopoietic, epithelial and endothelial cells. It participates in multiple signal transduction pathways. Phosphorylation of tyrosine 566 by Src kinase is required for activation of Etk in vivo. In endothelial and epithelial cells, Etk is regulated by FAK through phosphorylation at tyrosine 40.

Product Categories/Family for anti-BMX antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 34189854
• NCBI GeneID: 660
• UniProt Accession #: P51813; O60564; Q12871; A6NIH9
• Molecular Weight: 78,011 Da
• NCBI Official Full Name: Homo sapiens BMX non-receptor tyrosine kinase, mRNA
• NCBI Official Synonym Full Names: BMX non-receptor tyrosine kinase
• NCBI Official Symbol: BMX
• NCBI Official Synonym Symbols: ETK; PSCTK2; PSCTK3
• NCBI Protein Information: cytoplasmic tyrosine-protein kinase BMX
• UniProt Protein Name: Cytoplasmic tyrosine-protein kinase BMX
• Protein Family: Cytoplasmic tyrosine-protein kinase
• UniProt Gene Name: BMX
• UniProt Synonym Gene Names: ETK
• UniProt Entry Name: BMX_HUMAN

NCBI Description

This gene encodes a non-receptor tyrosine kinase belonging to the Tec kinase family. The protein contains a PH-like domain, which mediates membrane targeting by binding to phosphatidylinositol 3,4,5-triphosphate (PIP3), and a SH2 domain that binds to tyrosine-phosphorylated proteins and functions in signal transduction. The protein is implicated in several signal transduction pathways including the Stat pathway, and regulates differentiation and tumorigenicity of several types of cancer cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016]

Uniprot Description

Etk: a tyrosine kinase of the Tec family. Activity is required for IL6-induced differentiation. May play a role in the growth and differentiation of hematopoietic cells. May be involved in signal transduction in endocardial and arterial endothelial cells.

Protein type: EC 2.7.10.2; Protein kinase, tyrosine (non-receptor); Protein kinase, TK; Kinase, protein; TK group; Tec family

Chromosomal Location of Human Ortholog: Xp22.2

Cellular Component: extrinsic to internal side of plasma membrane; cytosol

Molecular Function: signal transducer activity; protein binding; protein-tyrosine kinase activity; metal ion binding; non-membrane spanning protein tyrosine kinase activity; ATP binding; receptor binding

Biological Process: B cell receptor signaling pathway; adaptive immune response; apoptosis; protein amino acid autophosphorylation; innate immune response; mesoderm development; cell adhesion; signal transduction; cell differentiation; T cell receptor signaling pathway; protein amino acid phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of cell proliferation; cell structure disassembly during apoptosis