Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse BMP7 Monoclonal Antibody | anti-BMP7 antibody

BMP7 (Bone Morphogenetic Protein 7, OP-1) (MaxLight 490)

Gene Names
BMP7; OP-1
Applications
FLISA
Purity
Purified
Synonyms
BMP7; Monoclonal Antibody; BMP7 (Bone Morphogenetic Protein 7; OP-1) (MaxLight 490); Bone Morphogenetic Protein 7; OP-1; anti-BMP7 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H3
Specificity
Recognizes BMP7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-BMP7 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BMP7 (NP_001710, 293aa-390aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-BMP7 antibody
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. [provided by RefSeq]
Product Categories/Family for anti-BMP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
655
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
bone morphogenetic protein 7 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 7
NCBI Official Symbol
BMP7
NCBI Official Synonym Symbols
OP-1
NCBI Protein Information
bone morphogenetic protein 7
UniProt Protein Name
Bone morphogenetic protein 7
UniProt Gene Name
BMP7
UniProt Synonym Gene Names
OP1; BMP-7; OP-1
UniProt Entry Name
BMP7_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone, kidney and brown adipose tissue development. Additionally, this protein induces ectopic bone formation and may promote fracture healing in human patients. [provided by RefSeq, Jul 2016]

Uniprot Description

BMP7: Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. Homodimer; disulfide-linked. Interacts with SOSTDC1. Interacts with TWSG1. Expressed in the kidney and bladder. Lower levels seen in the brain. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q13

Cellular Component: extracellular matrix; extracellular space; extracellular region

Molecular Function: heparin binding; protein binding; growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: negative regulation of MAP kinase activity; axon guidance; response to peptide hormone stimulus; extracellular matrix organization and biogenesis; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; negative regulation of NF-kappaB import into nucleus; embryonic pattern specification; response to estradiol stimulus; negative regulation of cell cycle; BMP signaling pathway; regulation of apoptosis; response to vitamin D; epithelial cell differentiation; ureteric bud development; dendrite development; mesonephros development; skeletal development; embryonic limb morphogenesis; ossification; positive regulation of heterotypic cell-cell adhesion; positive regulation of bone mineralization; odontogenesis of dentine-containing teeth; positive regulation of osteoblast differentiation; negative regulation of neuron differentiation; mesenchymal cell differentiation; branching morphogenesis of a tube; mesoderm formation; inhibition of NF-kappaB transcription factor; cartilage development; negative regulation of mitosis; epithelial to mesenchymal transition; negative regulation of phosphorylation; negative regulation of Notch signaling pathway; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; embryonic camera-type eye morphogenesis; negative regulation of transcription, DNA-dependent; metanephros development; neurite morphogenesis; growth

Research Articles on BMP7

Similar Products

Product Notes

The BMP7 bmp7 (Catalog #AAA6205347) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BMP7 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BMP7 bmp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BMP7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.