Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged BMP5 is 0.3 ng/ml as a capture antibody.)

Mouse BMP5 Monoclonal Antibody | anti-BMP5 antibody

BMP5 (Bone Morphogenetic Protein 5, MGC34244) (APC)

Applications
ELISA
Purity
Purified
Synonyms
BMP5; Monoclonal Antibody; BMP5 (Bone Morphogenetic Protein 5; MGC34244) (APC); Bone Morphogenetic Protein 5; MGC34244; anti-BMP5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G11
Specificity
Recognizes BMP5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-BMP5 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BMP5 (NP_066551.1, 341aa-440aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged BMP5 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BMP5 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-BMP5 antibody
This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. [provided by RefSeq]
Product Categories/Family for anti-BMP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
653
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,670 Da
NCBI Official Full Name
bone morphogenetic protein 5 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 5
NCBI Official Symbol
BMP5
NCBI Protein Information
bone morphogenetic protein 5; BMP-5; bone morphogenenic protein-5
UniProt Protein Name
Bone morphogenetic protein 5
UniProt Gene Name
BMP5
UniProt Synonym Gene Names
BMP-5
UniProt Entry Name
BMP5_HUMAN

NCBI Description

This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. [provided by RefSeq, Jul 2008]

Uniprot Description

BMP5: Induces cartilage and bone formation. Belongs to the TGF-beta family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: extracellular space

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: ossification; negative regulation of insulin-like growth factor receptor signaling pathway; pattern specification process; BMP signaling pathway; regulation of apoptosis; negative regulation of cell proliferation; cartilage development; regulation of MAPKKK cascade; negative regulation of aldosterone biosynthetic process; male genitalia development; positive regulation of transcription from RNA polymerase II promoter; skeletal development; positive regulation of epithelial cell proliferation; growth

Research Articles on BMP5

Similar Products

Product Notes

The BMP5 bmp5 (Catalog #AAA6167324) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BMP5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BMP5 bmp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BMP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.