Mouse BMP2K Monoclonal Antibody | anti-BMP2K antibody

BMP2K (BMP2 Inducible Kinase, BIKE, DKFZp434K0614, DKFZp434P0116, HRIHFB2017) (APC)

Cat. Num. AAA6166701

• Gene Names: BMP2K; BIKE; HRIHFB2017
• Applications: Western Blot
• Purity: Purified
• Synonyms: BMP2K; Monoclonal Antibody; BMP2K (BMP2 Inducible Kinase; BIKE; DKFZp434K0614; DKFZp434P0116; HRIHFB2017) (APC); BMP2 Inducible Kinase; HRIHFB2017; anti-BMP2K antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F11
• Specificity: Recognizes BMP2K.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 662

• Applicable Applications for anti-BMP2K antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: BMP2K (AAH36021, 540aa-650aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(BMP2K monoclonal antibody (M02), clone 1F11 Western Blot analysis of BMP2K expression in MCF-7.)

Testing Data

(Detection limit for recombinant GST tagged BMP2K is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of BMP2K expression in transfected 293T cell line by BMP2K monoclonal antibody (M02), clone 1F11.Lane 1: BMP2K transfected lysate(73.9 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-BMP2K antibody

This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-BMP2K antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 23271902
• NCBI GeneID: 55589
• NCBI Official Full Name: BMP2 inducible kinase
• NCBI Official Synonym Full Names: BMP2 inducible kinase
• NCBI Official Symbol: BMP2K
• NCBI Official Synonym Symbols: BIKE; HRIHFB2017
• NCBI Protein Information: BMP-2-inducible protein kinase
• Protein Family: BMP-2-inducible protein kinase

NCBI Description

This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]