Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human BLNK Monoclonal Antibody | anti-BLNK antibody

BLNK (B Cell Linker Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Cytoplasmic Adapter Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, BASH, SLP65) (FITC)

Gene Names
BLNK; bca; AGM4; BASH; LY57; SLP65; BLNK-S; SLP-65
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BLNK; Monoclonal Antibody; BLNK (B Cell Linker Protein; B Cell Adapter Containing a SH2 Domain Protein; B Cell Adapter Containing a Src Homology 2 Domain Protein; Cytoplasmic Adapter Protein; Src Homology 2 Domain-containing Leukocyte Protein of 65kD; SLP-65; BASH; SLP65) (FITC); anti-BLNK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D7
Specificity
Recognizes human BLNK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-BLNK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa301-401 from human BLNK (AAH18906) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRF*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between NCK1 and BLNK. HeLa cells were stained with NCK1 rabbit purified polyclonal 1:1200 and BLNK mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between NCK1 and BLNK. HeLa cells were stained with NCK1 rabbit purified polyclonal 1:1200 and BLNK mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-BLNK antibody
BLNK is a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in its gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia.
Product Categories/Family for anti-BLNK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
44,451 Da
NCBI Official Full Name
Homo sapiens B-cell linker, mRNA
NCBI Official Synonym Full Names
B-cell linker
NCBI Official Symbol
BLNK
NCBI Official Synonym Symbols
bca; AGM4; BASH; LY57; SLP65; BLNK-S; SLP-65
NCBI Protein Information
B-cell linker protein
Protein Family

NCBI Description

This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2012]

Research Articles on BLNK

Similar Products

Product Notes

The BLNK (Catalog #AAA6146134) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BLNK (B Cell Linker Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Cytoplasmic Adapter Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, BASH, SLP65) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BLNK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BLNK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BLNK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.