Mouse anti-Human BLNK Monoclonal Antibody | anti-BLNK antibody

BLNK (B Cell Linker Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Cytoplasmic Adapter Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, BASH, SLP65) (AP)

Cat. Num. AAA6130225

• Gene Names: BLNK; bca; AGM4; BASH; LY57; SLP65; BLNK-S; SLP-65
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BLNK; Monoclonal Antibody; BLNK (B Cell Linker Protein; B Cell Adapter Containing a SH2 Domain Protein; B Cell Adapter Containing a Src Homology 2 Domain Protein; Cytoplasmic Adapter Protein; Src Homology 2 Domain-containing Leukocyte Protein of 65kD; SLP-65; BASH; SLP65) (AP); anti-BLNK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D7
• Specificity: Recognizes human BLNK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-BLNK antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa301-401 from human BLNK (AAH18906) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRF*
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between NCK1 and BLNK. HeLa cells were stained with NCK1 rabbit purified polyclonal 1:1200 and BLNK mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-BLNK antibody

BLNK is a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in its gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia.

Product Categories/Family for anti-BLNK antibody

Antibodies; B Cells

NCBI and Uniprot Product Information

• NCBI GI #: 33879057
• NCBI GeneID: 29760
• Molecular Weight: 44,451 Da
• NCBI Official Full Name: Homo sapiens B-cell linker, mRNA
• NCBI Official Synonym Full Names: B-cell linker
• NCBI Official Symbol: BLNK
• NCBI Official Synonym Symbols: bca; AGM4; BASH; LY57; SLP65; BLNK-S; SLP-65
• NCBI Protein Information: B-cell linker protein
• Protein Family: B-cell linker protein

NCBI Description

This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2012]