Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human BIN1 Monoclonal Antibody | anti-BIN1 antibody

BIN1 (Myc Box-dependent-interacting Protein 1, Amphiphysin II, Amphiphysin-like Protein, Box-dependent Myc-interacting Protein 1, Bridging Integrator 1, AMPHL) (MaxLight 750)

Gene Names
BIN1; AMPH2; AMPHL; SH3P9
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BIN1; Monoclonal Antibody; BIN1 (Myc Box-dependent-interacting Protein 1; Amphiphysin II; Amphiphysin-like Protein; Box-dependent Myc-interacting Protein 1; Bridging Integrator 1; AMPHL) (MaxLight 750); anti-BIN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H1
Specificity
Recognizes human BIN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-BIN1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa355-454 from human BIN1 (NP_004296) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-BIN1 antibody
Box-dependent myc interacting protein 1 (BIN1) interacts with and inhibits the oncogenic activity of the myc oncoprotein and thus may act as a tumour suppressor.
Product Categories/Family for anti-BIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
274
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54,948 Da
NCBI Official Full Name
myc box-dependent-interacting protein 1 isoform 8
NCBI Official Synonym Full Names
bridging integrator 1
NCBI Official Symbol
BIN1
NCBI Official Synonym Symbols
AMPH2; AMPHL; SH3P9
NCBI Protein Information
myc box-dependent-interacting protein 1; amphiphysin II; amphiphysin-like protein; box dependant MYC interacting protein 1; box-dependent myc-interacting protein 1
UniProt Protein Name
Myc box-dependent-interacting protein 1
UniProt Gene Name
BIN1
UniProt Synonym Gene Names
AMPHL
UniProt Entry Name
BIN1_HUMAN

Uniprot Description

BIN1: May be involved in regulation of synaptic vesicle endocytosis. May act as a tumor suppressor and inhibits malignant cell transformation. Defects in BIN1 are the cause of centronuclear myopathy type 2 (CNM2). A congenital muscle disorder characterized by progressive muscular weakness and wasting involving mainly limb girdle, trunk, and neck muscles. It may also affect distal muscles. Weakness may be present during childhood or adolescence or may not become evident until the third decade of life. Ptosis is a frequent clinical feature. The most prominent histopathologic features include high frequency of centrally located nuclei in muscle fibers not secondary to regeneration, radial arrangement of sarcoplasmic strands around the central nuclei, and predominance and hypotrophy of type 1 fibers. 11 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Cytoskeletal; Adaptor/scaffold; Vesicle

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: I band; synaptic vesicle; membrane; axon; T-tubule; cytoplasm; nerve terminal; Z disc; nucleus; actin cytoskeleton

Molecular Function: identical protein binding; protein binding; GTPase binding; protein heterodimerization activity; protein complex binding; tau protein binding

Biological Process: cell proliferation; muscle cell differentiation; viral reproduction; regulation of neuron differentiation; positive regulation of apoptosis; positive regulation of endocytosis; endocytosis; positive regulation of GTPase activity; positive regulation of astrocyte differentiation

Disease: Myopathy, Centronuclear, 2

Similar Products

Product Notes

The BIN1 bin1 (Catalog #AAA6231784) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BIN1 (Myc Box-dependent-interacting Protein 1, Amphiphysin II, Amphiphysin-like Protein, Box-dependent Myc-interacting Protein 1, Bridging Integrator 1, AMPHL) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BIN1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BIN1 bin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BIN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.