Mouse anti-Human BIN1 Monoclonal Antibody | anti-BIN1 antibody

BIN1 (Myc Box-dependent-interacting Protein 1, Amphiphysin II, Amphiphysin-like Protein, Box-dependent Myc-interacting Protein 1, Bridging Integrator 1, AMPHL) (Biotin)

Cat. Num. AAA6140827

• Gene Names: BIN1; AMPH2; AMPHL; SH3P9
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BIN1; Monoclonal Antibody; BIN1 (Myc Box-dependent-interacting Protein 1; Amphiphysin II; Amphiphysin-like Protein; Box-dependent Myc-interacting Protein 1; Bridging Integrator 1; AMPHL) (Biotin); anti-BIN1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1H1
• Specificity: Recognizes human BIN1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-BIN1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa355-454 from human BIN1 (NP_004296) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(BIN1 monoclonal antibody Western Blot analysis of BIN1 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of BIN1 expression in transfected 293T cell line by BIN1 monoclonal antibody. Lane 1: BIN1 transfected lysate (53kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-BIN1 antibody

Box-dependent myc interacting protein 1 (BIN1) interacts with and inhibits the oncogenic activity of the myc oncoprotein and thus may act as a tumour suppressor.

Product Categories/Family for anti-BIN1 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 4757748
• NCBI GeneID: 274
• NCBI Accession #: NP_004296
• NCBI GenBank Nucleotide #: NM_004305
• UniProt Accession #: O00499; O00297; O00545; O43867; O60552; O60553; O60554; O60555; O75514; O75515; O75516; O75517
• Molecular Weight: 54,948 Da
• NCBI Official Full Name: myc box-dependent-interacting protein 1 isoform 8
• NCBI Official Synonym Full Names: bridging integrator 1
• NCBI Official Symbol: BIN1
• NCBI Official Synonym Symbols: AMPH2; AMPHL; SH3P9
• NCBI Protein Information: myc box-dependent-interacting protein 1; amphiphysin II; amphiphysin-like protein; box dependant MYC interacting protein 1; box-dependent myc-interacting protein 1
• UniProt Protein Name: Myc box-dependent-interacting protein 1
• Protein Family: Myc box-dependent-interacting protein
• UniProt Gene Name: BIN1
• UniProt Synonym Gene Names: AMPHL
• UniProt Entry Name: BIN1_HUMAN

Uniprot Description

BIN1: May be involved in regulation of synaptic vesicle endocytosis. May act as a tumor suppressor and inhibits malignant cell transformation. Defects in BIN1 are the cause of centronuclear myopathy type 2 (CNM2). A congenital muscle disorder characterized by progressive muscular weakness and wasting involving mainly limb girdle, trunk, and neck muscles. It may also affect distal muscles. Weakness may be present during childhood or adolescence or may not become evident until the third decade of life. Ptosis is a frequent clinical feature. The most prominent histopathologic features include high frequency of centrally located nuclei in muscle fibers not secondary to regeneration, radial arrangement of sarcoplasmic strands around the central nuclei, and predominance and hypotrophy of type 1 fibers. 11 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Cytoskeletal; Adaptor/scaffold; Vesicle

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: I band; synaptic vesicle; membrane; axon; T-tubule; cytoplasm; nerve terminal; Z disc; nucleus; actin cytoskeleton

Molecular Function: identical protein binding; protein binding; GTPase binding; protein heterodimerization activity; protein complex binding; tau protein binding

Biological Process: cell proliferation; muscle cell differentiation; viral reproduction; regulation of neuron differentiation; positive regulation of apoptosis; positive regulation of endocytosis; endocytosis; positive regulation of GTPase activity; positive regulation of astrocyte differentiation

Disease: Myopathy, Centronuclear, 2