Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (66.22kD).)

Mouse anti-Human BGN Monoclonal Antibody | anti-BGN antibody

BGN (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) APC

Gene Names
BGN; PGI; DSPG1; PG-S1; SEMDX; SLRR1A
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BGN; Monoclonal Antibody; BGN (Biglycan; Bone/Cartilage Proteoglycan I; PG-S1; SLRR1A) APC; anti-BGN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E1-1G7
Specificity
Recognizes human BGN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-BGN antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 1-10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-368 from human BGN (AAH02416.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (66.22kD).)

Western Blot (WB) (Western Blot detection against Immunogen (66.22kD).)

Western Blot (WB)

(123923 Western Blot analysis of BGN expression in HepG2.)

Western Blot (WB) (123923 Western Blot analysis of BGN expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of BGN expression in transfected 293T cell line using 123923. Lane 1: BGN transfected lysate (41.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BGN expression in transfected 293T cell line using 123923. Lane 1: BGN transfected lysate (41.7kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of BGN transfected lysate using 123923 and Protein A Magnetic Bead and immunoblotted with BGN rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of BGN transfected lysate using 123923 and Protein A Magnetic Bead and immunoblotted with BGN rabbit polyclonal antibody.)
Product Categories/Family for anti-BGN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
633
Molecular Weight
41,654 Da
NCBI Official Full Name
Homo sapiens biglycan, mRNA
NCBI Official Synonym Full Names
biglycan
NCBI Official Symbol
BGN
NCBI Official Synonym Symbols
PGI; DSPG1; PG-S1; SEMDX; SLRR1A
NCBI Protein Information
biglycan
Protein Family

NCBI Description

This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication. [provided by RefSeq, Nov 2015]

Research Articles on BGN

Similar Products

Product Notes

The BGN (Catalog #AAA6135518) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BGN (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BGN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 1-10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BGN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BGN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.