Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged BGLAP is 0.1 ng/ml as a capture antibody.)

Mouse BGLAP Monoclonal Antibody | anti-BGLAP antibody

BGLAP (Bone gamma-carboxyglutamate (gla) Protein, BGP, OC, PMF1) (Biotin)

Gene Names
BGLAP; OC; BGP; OCN
Applications
Western Blot
Purity
Purified
Synonyms
BGLAP; Monoclonal Antibody; BGLAP (Bone gamma-carboxyglutamate (gla) Protein; BGP; OC; PMF1) (Biotin); Bone gamma-carboxyglutamate (gla) Protein; PMF1; anti-BGLAP antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
2D5
Specificity
Recognizes BGLAP.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BGLAP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BGLAP (NP_954642, 52aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged BGLAP is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BGLAP is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-BGLAP antibody
Mouse monoclonal antibody raised against a partial recombinant BGLAP.
Product Categories/Family for anti-BGLAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
632
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
osteocalcin preproprotein
NCBI Official Synonym Full Names
bone gamma-carboxyglutamate protein
NCBI Official Symbol
BGLAP
NCBI Official Synonym Symbols
OC; BGP; OCN
NCBI Protein Information
osteocalcin
UniProt Protein Name
Osteocalcin
Protein Family
UniProt Gene Name
BGLAP
UniProt Synonym Gene Names
BGP
UniProt Entry Name
OSTCN_HUMAN

NCBI Description

This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]

Uniprot Description

osteocalcin: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Belongs to the osteocalcin/matrix Gla protein family.

Protein type: Secreted, signal peptide; Secreted; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: Golgi apparatus; extracellular space; rough endoplasmic reticulum; dendrite; cytoplasm; perikaryon

Molecular Function: structural constituent of bone; hydroxyapatite binding; calcium ion binding; structural molecule activity

Biological Process: response to drug; response to gravity; regulation of bone resorption; response to glucocorticoid stimulus; cell aging; response to testosterone stimulus; bone mineralization; osteoblast development; odontogenesis; osteoblast differentiation; regulation of osteoclast differentiation; response to ethanol; response to vitamin D; response to vitamin K; response to estrogen stimulus; response to mechanical stimulus; response to zinc ion; response to hydroxyisoflavone; response to activity; cell adhesion; regulation of bone mineralization; skeletal development

Research Articles on BGLAP

Similar Products

Product Notes

The BGLAP bglap (Catalog #AAA6173872) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BGLAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BGLAP bglap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BGLAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.