Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Mouse anti-Human BCL11A Monoclonal Antibody | anti-BCL11A antibody

BCL11A (CTIP1, EVI9, KIAA1809, ZNF856, B Cell Lymphoma/Leukemia 11A, B Cell CLL/Lymphoma 11A, COUP-TF-interacting Protein 1, Ecotropic Viral Integration Site 9 Protein Homolog, Zinc Finger Protein 856, FLJ10173, FLJ34997, HBFQTL5) (FITC)

Gene Names
BCL11A; EVI9; CTIP1; ZNF856; HBFQTL5; BCL11A-L; BCL11A-S; BCL11a-M; BCL11A-XL
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BCL11A; Monoclonal Antibody; BCL11A (CTIP1; EVI9; KIAA1809; ZNF856; B Cell Lymphoma/Leukemia 11A; B Cell CLL/Lymphoma 11A; COUP-TF-interacting Protein 1; Ecotropic Viral Integration Site 9 Protein Homolog; Zinc Finger Protein 856; FLJ10173; FLJ34997; HBFQTL5) (FITC); anti-BCL11A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D9
Specificity
Recognizes human BCL11A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-BCL11A antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-89 from human BCL11A (NP_060484) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.79kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Western Blot (WB)

(Western Blot analysis of BCL11A expression in transfected 293T cell line by BCL11A monoclonal antibody. Lane 1: BCL11A transfected lysate (26.865kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BCL11A expression in transfected 293T cell line by BCL11A monoclonal antibody. Lane 1: BCL11A transfected lysate (26.865kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to BCL11A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to BCL11A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-BCL11A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,554 Da
NCBI Official Full Name
B-cell lymphoma/leukemia 11A isoform 2
NCBI Official Synonym Full Names
B-cell CLL/lymphoma 11A (zinc finger protein)
NCBI Official Symbol
BCL11A
NCBI Official Synonym Symbols
EVI9; CTIP1; ZNF856; HBFQTL5; BCL11A-L; BCL11A-S; BCL11a-M; BCL11A-XL
NCBI Protein Information
B-cell lymphoma/leukemia 11A; B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2; BCL-11A; BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1; C2H2-type zinc finger protein; COUP-TF-interacting protein 1; EVI-9; ecotropic viral integratio
UniProt Protein Name
B-cell lymphoma/leukemia 11A
Protein Family
UniProt Gene Name
BCL11A
UniProt Synonym Gene Names
CTIP1; EVI9; KIAA1809; ZNF856; BCL-11A; EVI-9
UniProt Entry Name
BC11A_HUMAN

Uniprot Description

Bcl-11A: Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. Chromosomal aberrations involving BCL11A may be a cause of lymphoid malignancies. Translocation t(2;14)(p13;q32.3) causes BCL11A deregulation and amplification. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; C2H2-type zinc finger protein; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 2p16.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein homodimerization activity; protein heterodimerization activity; metal ion binding; transcription corepressor activity

Biological Process: protein sumoylation; transcription, DNA-dependent; B cell differentiation; regulation of dendrite development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of collateral sprouting; negative regulation of transcription from RNA polymerase II promoter; negative regulation of axon extension; positive regulation of collateral sprouting; negative regulation of protein homooligomerization; T cell differentiation

Similar Products

Product Notes

The BCL11A bcl11a (Catalog #AAA6146107) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BCL11A (CTIP1, EVI9, KIAA1809, ZNF856, B Cell Lymphoma/Leukemia 11A, B Cell CLL/Lymphoma 11A, COUP-TF-interacting Protein 1, Ecotropic Viral Integration Site 9 Protein Homolog, Zinc Finger Protein 856, FLJ10173, FLJ34997, HBFQTL5) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCL11A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BCL11A bcl11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BCL11A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.