<
Western Blot (WB)
(Western Blot detection against Immunogen (38.87kD).)
Mouse anti-Human, Rat BCAP29 Monoclonal Antibody | anti-BCAP29 antibody
BCAP29 (B-Cell Receptor-Associated Protein 29, BCR-associated Protein 29, BAP29, DKFZp686M2086) (AP)
Gene Names
BCAP29; BAP29
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BCAP29; Monoclonal Antibody; BCAP29 (B-Cell Receptor-Associated Protein 29; BCR-associated Protein 29; BAP29; DKFZp686M2086) (AP); anti-BCAP29 antibody
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B10
Specificity
Recognizes human BCAP29. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-BCAP29 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa125-241 from human BCAP29 (AAH08478) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.87kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.87kD).)
Western Blot (WB)
(BCAP29 monoclonal antibody, Western Blot analysis of BCAP29 expression in PC-12.)
Western Blot (WB)
(BCAP29 monoclonal antibody, Western Blot analysis of BCAP29 expression in PC-12.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to BCAP29 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to BCAP29 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to BCAP29 on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to BCAP29 on HeLa cell. [antibody concentration 10ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged BCAP29 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged BCAP29 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-BCAP29 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
40,797 Da
NCBI Official Full Name
Homo sapiens B-cell receptor-associated protein 29, mRNA
NCBI Official Synonym Full Names
B-cell receptor associated protein 29
NCBI Official Symbol
BCAP29
NCBI Official Synonym Symbols
BAP29
NCBI Protein Information
B-cell receptor-associated protein 29
Protein Family
Research Articles on BCAP29
Similar Products
Product Notes
The BCAP29 (Catalog #AAA6130193) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BCAP29 (B-Cell Receptor-Associated Protein 29, BCR-associated Protein 29, BAP29, DKFZp686M2086) (AP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BCAP29 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BCAP29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BCAP29, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
