Mouse BANF1 Monoclonal Antibody | anti-BANF1 antibody

BANF1 (Barrier to Autointegration Factor 1, BAF, BCRP1, D14S1460, MGC111161) (Biotin)

Cat. Num. AAA6170631

• Gene Names: BANF1; BAF; NGPS; BCRP1; D14S1460
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: BANF1; Monoclonal Antibody; BANF1 (Barrier to Autointegration Factor 1; BAF; BCRP1; D14S1460; MGC111161) (Biotin); Barrier to Autointegration Factor 1; MGC111161; anti-BANF1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: M2
• Specificity: Recognizes BANF1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-BANF1 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: BANF1 (AAH05942, 1aa-89aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BANF1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BANF1 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged BANF1 is approximately 10ng/ml as a capture antibody.)

Western Blot (WB)

(BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in Jurkat.)

Western Blot (WB)

(BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in Raw 264.7.)

Western Blot (WB)

(BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in PC-12.)

Related Product Information for anti-BANF1 antibody

The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.

Product Categories/Family for anti-BANF1 antibody

Antibodies; Proteins

References

1. Functional Disruption of the Moloney Murine Leukemia Virus Preintegration Complex by Vaccinia-related Kinases. Suzuki Y, Ogawa K, Koyanagi Y, Suzuki Y.J Biol Chem. 2010 Jul 30;285(31):24032-43. Epub 2010 May 28.

NCBI and Uniprot Product Information

• NCBI GI #: 13543577
• NCBI GeneID: 8815
• UniProt Accession #: O75531; O60558; Q6FGG7
• Molecular Weight: 10,059 Da
• NCBI Official Full Name: Barrier to autointegration factor 1
• NCBI Official Synonym Full Names: barrier to autointegration factor 1
• NCBI Official Symbol: BANF1
• NCBI Official Synonym Symbols: BAF; NGPS; BCRP1; D14S1460
• NCBI Protein Information: barrier-to-autointegration factor; breakpoint cluster region protein 1
• UniProt Protein Name: Barrier-to-autointegration factor
• Protein Family: Barrier-to-autointegration factor
• UniProt Gene Name: BANF1
• UniProt Synonym Gene Names: BAF; BCRG1
• UniProt Entry Name: BAF_HUMAN

NCBI Description

The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Jan 2009]

Uniprot Description

BAF: Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging. Exploited by retroviruses for inhibiting self- destructing autointegration of retroviral DNA, thereby promoting integration of viral DNA into the host chromosome. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. Defects in BANF1 are the cause of Nestor-Guillermo progeria syndrome (NGPS). NGPS is an atypical progeroid syndrome characterized by normal development in the first years of life, later followed by the emergence of generalized lipoatrophy, severe osteoporosis, and marked osteolysis. The atrophic facial subcutaneous fat pad and the marked osteolysis of the maxilla and mandible result in a typical pseudosenile facial appearance with micrognatia, prominent subcutaneous venous patterning, a convex nasal ridge, and proptosis. Cognitive development is completely normal. Patients do not have cardiovascular dysfunction, atherosclerosis, or metabolic anomalies. Belongs to the BAF family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 11q13.1

Cellular Component: nucleoplasm; cytoplasm; chromosome; nucleus; cytosol

Molecular Function: protein binding; DNA binding

Biological Process: mitotic nuclear envelope reassembly; viral reproduction; DNA integration; response to virus; mitotic nuclear envelope disassembly; mitotic cell cycle

Disease: Nestor-guillermo Progeria Syndrome