Mouse anti-Human BANF1 Monoclonal Antibody | anti-BANF1 antibody

BANF1 (Barrier-to-autointegration Factor, Breakpoint Cluster Region Protein 1, BAF, BCRG1, D14S1460, MGC111161) (Biotin)

Cat. Num. AAA6140787

• Gene Names: BANF1; BAF; NGPS; BCRP1; D14S1460
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BANF1; Monoclonal Antibody; BANF1 (Barrier-to-autointegration Factor; Breakpoint Cluster Region Protein 1; BAF; BCRG1; D14S1460; MGC111161) (Biotin); anti-BANF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F10-4G12
• Specificity: Recognizes human BANF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-BANF1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-90 from BANF1 (AAH05942) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB)

(BANF1 monoclonal antibody 2 Western Blot analysis of BANF1 expression in Jurkat.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to BANF1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged BANF1 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-BANF1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13543576
• NCBI GeneID: 8815
• Molecular Weight: 10,059 Da
• NCBI Official Full Name: Homo sapiens barrier to autointegration factor 1, mRNA
• NCBI Official Synonym Full Names: barrier to autointegration factor 1
• NCBI Official Symbol: BANF1
• NCBI Official Synonym Symbols: BAF; NGPS; BCRP1; D14S1460
• NCBI Protein Information: barrier-to-autointegration factor
• Protein Family: Barrier-to-autointegration factor

NCBI Description

The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Jan 2009]