Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human BAG2 Monoclonal Antibody | anti-BAG2 antibody

BAG2 (BAG Family Molecular Chaperone Regulator 2, BAG-2, Bcl-2-associated Athanogene 2, dJ417I1.2, KIAA0576, MGC149462) (Biotin)

Gene Names
BAG2; BAG-2; dJ417I1.2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BAG2; Monoclonal Antibody; BAG2 (BAG Family Molecular Chaperone Regulator 2; BAG-2; Bcl-2-associated Athanogene 2; dJ417I1.2; KIAA0576; MGC149462) (Biotin); anti-BAG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6E12
Specificity
Recognizes human BAG2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BAG2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa102-212 from BAG2 (NP_004273) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAESRFN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(BAG2 monoclonal antibody Western Blot analysis of BAG2 expression in HeLa.)

Western Blot (WB) (BAG2 monoclonal antibody Western Blot analysis of BAG2 expression in HeLa.)
Related Product Information for anti-BAG2 antibody
Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.
Product Categories/Family for anti-BAG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,189 Da
NCBI Official Full Name
BAG family molecular chaperone regulator 2
NCBI Official Synonym Full Names
BCL2 associated athanogene 2
NCBI Official Symbol
BAG2
NCBI Official Synonym Symbols
BAG-2; dJ417I1.2
NCBI Protein Information
BAG family molecular chaperone regulator 2
UniProt Protein Name
BAG family molecular chaperone regulator 2
UniProt Gene Name
BAG2
UniProt Synonym Gene Names
BAG-2
UniProt Entry Name
BAG2_HUMAN

NCBI Description

BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. [provided by RefSeq, Jul 2008]

Uniprot Description

BAG2: Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 6p12.1-p11.2

Molecular Function: identical protein binding; protein binding; chaperone binding

Biological Process: protein folding; protein metabolic process

Research Articles on BAG2

Similar Products

Product Notes

The BAG2 bag2 (Catalog #AAA6140779) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BAG2 (BAG Family Molecular Chaperone Regulator 2, BAG-2, Bcl-2-associated Athanogene 2, dJ417I1.2, KIAA0576, MGC149462) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAG2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAG2 bag2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.