Mouse anti-Human BAD Monoclonal Antibody | anti-BAD antibody

BAD (Bcl2 Antagonist of Cell Death, Bcl-2-binding Component 6, Bcl-2-like Protein 8, Bcl2-L-8, Bcl-XL/Bcl-2-associated Death Promoter, BBC6, BCL2L8) (MaxLight 405)

Cat. Num. AAA6189033

• Gene Names: BAD; BBC2; BCL2L8
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BAD; Monoclonal Antibody; BAD (Bcl2 Antagonist of Cell Death; Bcl-2-binding Component 6; Bcl-2-like Protein 8; Bcl2-L-8; Bcl-XL/Bcl-2-associated Death Promoter; BBC6; BCL2L8) (MaxLight 405); anti-BAD antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a, lambda
• Clone Number: 3H8
• Specificity: Recognizes human BAD.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

• Applicable Applications for anti-BAD antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa69-168 from human BAD (AAH01901) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
• Conjugate: MaxLight405
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-BAD antibody

Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain containing pro-apoptotic proteins, such as Bax, Bid, and Bik, form a growing subclass of the Bcl-2 family. Another such protein is the Bcl-2-antagonist of cell death (Bad). Bad regulates apoptosis by forming heterodimers with anti-apoptotic proteins Bcl-2 and Bcl-xL, thereby preventing them from binding with Bax. Bad activity is regulated by its phosphorylation; it is inactivated by kinases such as Akt and MAP kinase and thus promotes cell survival, whereas JNK-induced phosphorylation promotes the apoptotic role of Bad.

Product Categories/Family for anti-BAD antibody

Antibodies; Apoptosis

References

1. ZIC1 Is Downregulated through Promoter Hypermethylation, and Functions as a Tumor Suppressor Gene in Colorectal Cancer. Gan L, Chen S, Zhong J, Wang X, Lam EK, Liu X, Zhang J, Zhou T, Yu J, Si J, Wang L, Jin H.PLoS One. 2011 Feb 15;6(2):e16916.

NCBI and Uniprot Product Information

• NCBI GI #: 34783110
• NCBI GeneID: 572
• Molecular Weight: 18,392 Da
• NCBI Official Full Name: Homo sapiens BCL2-associated agonist of cell death, mRNA
• NCBI Official Synonym Full Names: BCL2 associated agonist of cell death
• NCBI Official Symbol: BAD
• NCBI Official Synonym Symbols: BBC2; BCL2L8
• NCBI Protein Information: bcl2-associated agonist of cell death
• Protein Family: Bcl2-associated agonist of cell death

NCBI Description

The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Jul 2008]