Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD).)

Mouse anti-Human, Mouse BACH1 Monoclonal Antibody | anti-BACH1 antibody

BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303) (PE)

Gene Names
BACH1; BACH-1; BTBD24
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BACH1; Monoclonal Antibody; BACH1 (Transcription Regulator Protein BACH1; BTB and CNC Homolog 1; HA2303) (PE); anti-BACH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B8
Specificity
Recognizes human BACH1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
736
Applicable Applications for anti-BACH1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa396-492 from human BACH1 (NP_996749) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB)

(BACH1 monoclonal antibody, Western Blot analysis of BACH1 expression in NIH/3T3.)

Western Blot (WB) (BACH1 monoclonal antibody, Western Blot analysis of BACH1 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged BACH1 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged BACH1 is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-BACH1 antibody
ubiquitously expressed member of the Bach family of transcription factors. Although its predicted MW is 82kD, it runs anomalously at 110kD in SDS-PAGE. BACH1 forms noncovalent homodimers, and heterodimers with Maf oncoproteins and p53-related proteins. It apparently serves as an architectural component for gene regulatory protein complexes. Human BACH1 is 736 aa in length. It contains a protein-interaction BTB domain (aa 24-127), a DNA-binding motif (aa 562-577), and a Leu-zipper domain (aa 585-607). This molecule should not be confused with Bach1/Fancj/Brip1 helicase. There are two BACH1 splice variants with a 24 and 31aa substitution for aa593-736, respectively. Over aa 133-513, human BACH1 shares 75% aa identity with mouse BACH1.
Product Categories/Family for anti-BACH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
571
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
transcription regulator protein BACH1
NCBI Official Synonym Full Names
BTB domain and CNC homolog 1
NCBI Official Symbol
BACH1
NCBI Official Synonym Symbols
BACH-1; BTBD24
NCBI Protein Information
transcription regulator protein BACH1
UniProt Protein Name
Transcription regulator protein BACH1
UniProt Gene Name
BACH1
UniProt Entry Name
BACH1_HUMAN

NCBI Description

This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, May 2009]

Uniprot Description

BACH1: a transcriptional regulator that acts as a repressor or activator. Binds, in-vitro, to NF-E2 binding sites on DNA. Plays an important role in coordinating transcription activation and repression by NF-E2. Belongs to the bZIP family, CNC subfamily.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: heme binding; transcription factor activity

Biological Process: G1/S-specific transcription in mitotic cell cycle; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; G2/M-specific transcription in mitotic cell cycle

Research Articles on BACH1

Similar Products

Product Notes

The BACH1 bach1 (Catalog #AAA6156684) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's BACH1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BACH1 bach1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BACH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.